You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTyrosine-protein phosphatase non-receptor type 9
Synonyms
  • 3.1.3.48
  • Protein-tyrosine phosphatase MEG2
  • PTPase MEG2
Gene NamePTPN9
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019700|Tyrosine-protein phosphatase non-receptor type 9
MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLR
AIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPH
KSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFP
ARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECLPENLGGYVK
IDLATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQK
QGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINA
SFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEK
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASL
IDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGT
LNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ
Number of residues593
Molecular Weight68019.58
Theoretical pINot Available
GO Classification
Functions
  • protein tyrosine phosphatase activity
  • non-membrane spanning protein tyrosine phosphatase activity
Processes
  • peptidyl-tyrosine dephosphorylation
  • protein dephosphorylation
Components
  • cytoplasm
General FunctionProtein tyrosine phosphatase activity
Specific FunctionProtein-tyrosine phosphatase that could participate in the transfer of hydrophobic ligands or in functions of the Golgi apparatus.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP43378
UniProtKB Entry NamePTN9_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0019701|Tyrosine-protein phosphatase non-receptor type 9 (PTPN9)
ATGGAGCCCGCGACCGCGCCCCGGCCCGACATGGCGCCGGAGCTGACCCCGGAGGAGGAG
CAGGCTACCAAGCAGTTTCTCGAAGAGATTAACAAGTGGACAGTTCAGTACAATGTTTCC
CCGCTGTCTTGGAATGTGGCTGTCAAGTTCCTCATGGCAAGGAAGTTTGATGTGCTCCGT
GCCATAGAATTGTTCCACTCCTACAGAGAAACTCGAAGGAAGGAAGGCATTGTAAAGCTG
AAACCTCATGAGGAACCTCTTCGTTCTGAGATCCTCAGTGGAAAATTCACCATCTTAAAT
GTTCGGGACCCAACAGGAGCCTCCATTGCCCTCTTTACTGCCAGGTTGCATCATCCCCAC
AAGTCAGTCCAACATGTGGTACTTCAGGCTCTGTTTTACTTGCTAGACAGAGCTGTGGAT
AGCTTTGAAACTCAGAGGAATGGACTGGTGTTTATCTATGACATGTGTGGTTCTAATTAT
GCCAACTTTGAGCTGGATCTTGGCAAGAAAGTCCTAAACCTGCTGAAGGGAGCATTTCCA
GCTCGTTTGAAGAAGGTGCTGATTGTGGGGGCACCCATATGGTTCCGAGTGCCCTATTCC
ATCATCAGTCTCCTCCTGAAGGACAAAGTCCGGGAGAGGATTCAAATATTAAAGACATCT
GAGGTCACGCAGCATCTGCCCAGGGAGTGTCTTCCAGAAAACCTGGGTGGGTACGTCAAA
ATTGATCTCGCCACTTGGAATTTCCAGTTCCTACCCCAGGTGAACGGCCACCCAGATCCC
TTCGATGAGATCATCCTGTTCTCCCTCCCTCCTGCCTTAGACTGGGACTCAGTACATGTT
CCAGGTCCCCATGCTATGACCATCCAAGAGTTGGTGGACTATGTTAATGCCAGGCAAAAG
CAAGGAATCTATGAGGAATATGAAGACATTCGTCGTGAGAACCCTGTTGGCACTTTCCAC
TGTTCCATGTCTCCAGGAAACCTAGAGAAAAACCGTTATGGGGATGTACCCTGCCTGGAC
CAAACTAGAGTGAAGCTAACAAAGCGAAGTGGCCATACTCAGACAGATTACATCAATGCC
AGTTTCATGGATGGCTACAAGCAGAAGAATGCTTACATTGGCACACAAGGTCCTTTGGAG
AATACCTATCGTGATTTCTGGCTCATGGTATGGGAGCAAAAAGTCTTGGTGATTGTCATG
ACCACCCGCTTTGAGGAAGGCGGCAGGAGAAAGTGTGGCCAGTACTGGCCTTTAGAAAAA
GACTCTCGGATCCGATTTGGCTTCCTCACAGTGACCAATCTAGGCGTGGAGAACATGAAT
CATTATAAGAAAACAACGCTAGAAATTCACAACACAGAGGAACGGCAGAAACGCCAGGTG
ACCCACTTCCAGTTCTTGAGCTGGCCAGACTATGGTGTCCCTTCCTCAGCAGCTTCCCTC
ATTGACTTCTTGAGAGTGGTCAGAAACCAGCAGAGTCTGGCTGTGAGCAACATGGGAGCA
CGCTCCAAAGGGCAGTGCCCTGAGCCACCCATTGTGGTCCATTGCAGTGCAGGCATTGGC
AGGACAGGTACCTTCTGCTCACTGGACATCTGCCTGGCACAGCTGGAGGAGCTTGGCACC
CTTAATGTGTTCCAGACGGTGTCACGCATGAGGACCCAGAGGGCCTTCAGCATCCAGACC
CCTGAGCAGTACTATTTTTGCTACAAGGCCATCCTGGAGTTCGCAGAGAAGGAGGGCATG
GTATCCTCTGGCCAAAACCTGCTGGCCGTGGAGAGTCAGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9661
Chromosome Location15
LocusNot Available
References
  1. Gu M, Warshawsky I, Majerus PW: Cloning and expression of a cytosolic megakaryocyte protein-tyrosine-phosphatase with sequence homology to retinaldehyde-binding protein and yeast SEC14p. Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):2980-4. 1557404
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  5. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  6. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. 19167335