You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
Name5-hydroxytryptamine receptor 5A
Synonyms
  • 5-HT-5
  • Serotonin receptor 5A
Gene NameHTR5A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0020790|5-hydroxytryptamine receptor 5A
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Number of residues357
Molecular Weight40254.69
Theoretical pINot Available
GO Classification
Functions
  • serotonin receptor activity
Processes
  • G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
  • serotonin receptor signaling pathway
  • hippocampus development
  • cAMP-mediated signaling
  • response to estradiol
  • G-protein coupled receptor signaling pathway
Components
  • perikaryon
  • rough endoplasmic reticulum
  • plasma membrane
  • Golgi apparatus
  • integral component of plasma membrane
  • dendrite
General FunctionSerotonin receptor activity
Specific FunctionThis is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins.
Pfam Domain Function
Transmembrane Regions41-63 79-99 116-137 159-181 199-219 283-303 321-341
GenBank Protein IDNot Available
UniProtKB IDP47898
UniProtKB Entry Name5HT5A_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0020791|5-hydroxytryptamine receptor 5A (HTR5A)
ATGGATTTACCTGTGAACCTAACCTCCTTTTCCCTCTCCACCCCCTCCCCTTTGGAGACC
AACCACAGCCTCGGCAAAGACGACCTGCGCCCCAGCTCGCCCCTGCTCTCGGTCTTCGGA
GTGCTTATTCTCACCTTGCTGGGCTTTCTGGTGGCGGCGACGTTCGCCTGGAACCTGCTG
GTGCTGGCGACCATCCTCCGTGTACGCACCTTCCACCGCGTGCCCCACAACCTGGTGGCA
TCCATGGCCGTCTCGGATGTCCTGGTGGCCGCGCTGGTCATGCCGCTGAGCCTGGTGCAC
GAGCTGTCCGGGCGCCGCTGGCAGCTAGGTCGGAGGCTGTGCCAGCTTTGGATCGCGTGC
GACGTGCTTTGCTGCACGGCCAGCATCTGGAACGTGACGGCCATAGCCCTGGACCGCTAC
TGGTCCATCACGCGCCACATGGAATACACGCTCCGCACCCGCAAGTGCGTCTCCAACGTC
ATGATCGCGCTCACCTGGGCACTCTCCGCTGTCATCTCTCTGGCCCCGCTGCTTTTTGGC
TGGGGAGAGACGTACTCTGAGGGCAGCGAGGAGTGCCAGGTAAGCCGCGAGCCTTCCTAC
GCCGTGTTCTCCACCGTAGGCGCCTTCTACCTGCCGCTCTGTGTGGTGCTCTTCGTGTAC
TGGAAGATCTACAAGGCTGCCAAGTTCCGCGTGGGCTCCAGGAAGACCAATAGCGTCTCA
CCCATATCCGAAGCTGTGGAGGTGAAGGACTCTGCCAAACAGCCCCAGATGGTGTTCACG
GTCCGCCACGCCACCGTCACCTTCCAGCCAGAAGGGGACACGTGGCGGGAGCAGAAGGAG
CAGCGGGCCGCCCTCATGGTGGGCATCCTCATTGGCGTGTTCGTGCTCTGCTGGATCCCC
TTCTTTCTCACCGAGCTCATCAGTCCCCTCTGCTCCTGTGACATCCCCGCCATCTGGAAA
AGCATCTTCCTGTGGCTTGGCTACTCCAACTCCTTCTTTAACCCCCTGATCTATACGGCT
TTCAACAAGAACTACAACAGCGCCTTCAAGAACTTCTTTTCTAGGCAACACTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:5300
Chromosome Location7
LocusNot Available
References
  1. Rees S, den Daas I, Foord S, Goodson S, Bull D, Kilpatrick G, Lee M: Cloning and characterisation of the human 5-HT5A serotonin receptor. FEBS Lett. 1994 Dec 5;355(3):242-6. 7988681
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974