NameProtoporphyrinogen oxidase
Synonyms
  • 1.3.3.4
  • PPO
Gene NamePPOX
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017745|Protoporphyrinogen oxidase
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Number of residues477
Molecular Weight50764.8
Theoretical pINot Available
GO Classification
Functions
  • oxygen-dependent protoporphyrinogen oxidase activity
  • flavin adenine dinucleotide binding
Processes
  • response to drug
  • small molecule metabolic process
  • oxidation-reduction process
  • heme biosynthetic process
  • porphyrin-containing compound metabolic process
  • protoporphyrinogen IX biosynthetic process
  • porphyrin-containing compound biosynthetic process
Components
  • integral component of mitochondrial inner membrane
  • intrinsic component of mitochondrial inner membrane
  • mitochondrial membrane
  • mitochondrial intermembrane space
General FunctionOxygen-dependent protoporphyrinogen oxidase activity
Specific FunctionCatalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP50336
UniProtKB Entry NamePPOX_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0017746|Protoporphyrinogen oxidase (PPOX)
ATGGGCCGGACCGTGGTCGTGCTGGGCGGAGGCATCAGCGGCTTGGCCGCCAGTTACCAC
CTGAGCCGGGCCCCCTGCCCCCCTAAGGTGGTCCTAGTGGAGAGCAGTGAGCGTCTGGGA
GGCTGGATTCGCTCCGTTCGAGGCCCTAATGGTGCTATCTTTGAGCTTGGACCTCGGGGA
ATTAGGCCAGCGGGAGCCCTAGGGGCCCGGACCTTGCTCCTGGTTTCTGAGCTTGGCTTG
GATTCAGAAGTGCTGCCTGTCCGGGGAGACCACCCAGCTGCCCAGAACAGGTTCCTCTAC
GTGGGCGGTGCCCTGCATGCCCTACCCACTGGCCTCAGGGGGCTACTCCGCCCTTCACCC
CCCTTCTCCAAACCTCTGTTTTGGGCTGGGCTGAGGGAGCTGACCAAGCCCCGGGGCAAA
GAGCCTGATGAGACTGTGCACAGTTTTGCCCAGCGCCGCCTTGGACCTGAGGTGGCGTCT
CTAGCCATGGACAGTCTCTGCCGTGGAGTGTTTGCAGGCAACAGCCGTGAGCTCAGCATC
AGGTCCTGCTTTCCCAGTCTCTTCCAAGCTGAGCAAACCCATCGTTCCATATTACTGGGC
CTGCTGCTGGGGGCAGGGCGGACCCCACAGCCAGACTCAGCACTCATTCGCCAGGCCTTG
GCTGAGCGCTGGAGCCAGTGGTCACTTCGTGGAGGTCTAGAGATGTTGCCTCAGGCCCTT
GAAACCCACCTGACTAGTAGGGGGGTCAGTGTTCTCAGAGGCCAGCCGGTCTGTGGGCTC
AGCCTCCAGGCAGAAGGGCGCTGGAAGGTATCTCTAAGGGACAGCAGTCTGGAGGCTGAC
CACGTTATTAGTGCCATTCCAGCTTCAGTGCTCAGTGAGCTGCTCCCTGCTGAGGCTGCC
CCTCTGGCTCGTGCCCTGAGTGCCATCACTGCAGTGTCTGTAGCTGTGGTGAATCTGCAG
TACCAAGGAGCCCATCTGCCTGTCCAGGGATTTGGACATTTGGTGCCATCTTCAGAAGAT
CCAGGAGTCCTGGGAATCGTGTATGACTCAGTTGCTTTCCCTGAGCAGGACGGGAGCCCC
CCTGGCCTCAGAGTGACTGTGATGCTGGGAGGTTCCTGGTTACAGACACTGGAGGCTAGT
GGCTGTGTCTTATCTCAGGAGCTGTTTCAACAGCGGGCCCAGGAAGCAGCTGCTACACAA
TTAGGACTGAAGGAGATGCCGAGCCACTGCTTGGTCCATCTACACAAGAACTGCATTCCC
CAGTATACACTAGGTCACTGGCAAAAACTAGAGTCAGCTAGGCAATTCCTGACTGCTCAC
AGGTTGCCCCTGACTCTGGCTGGAGCCTCCTATGAGGGAGTTGCTGTTAATGACTGTATA
GAGAGTGGGCGCCAGGCAGCAGTCAGTGTCCTGGGCACAGAACCTAACAGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9280
Chromosome Location1
LocusNot Available
References
  1. Nishimura K, Taketani S, Inokuchi H: Cloning of a human cDNA for protoporphyrinogen oxidase by complementation in vivo of a hemG mutant of Escherichia coli. J Biol Chem. 1995 Apr 7;270(14):8076-80. 7713909
  2. Dailey TA, Dailey HA: Human protoporphyrinogen oxidase: expression, purification, and characterization of the cloned enzyme. Protein Sci. 1996 Jan;5(1):98-105. 8771201
  3. Puy H, Robreau AM, Rosipal R, Nordmann Y, Deybach JC: Protoporphyrinogen oxidase: complete genomic sequence and polymorphisms in the human gene. Biochem Biophys Res Commun. 1996 Sep 4;226(1):226-30. 8806618
  4. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  7. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  8. Qin X, Tan Y, Wang L, Wang Z, Wang B, Wen X, Yang G, Xi Z, Shen Y: Structural insight into human variegate porphyria disease. FASEB J. 2011 Feb;25(2):653-64. doi: 10.1096/fj.10-170811. Epub 2010 Nov 3. 21048046
  9. Wang B, Wen X, Qin X, Wang Z, Tan Y, Shen Y, Xi Z: Quantitative structural insight into human variegate porphyria disease. J Biol Chem. 2013 Apr 26;288(17):11731-40. doi: 10.1074/jbc.M113.459768. Epub 2013 Mar 6. 23467411
  10. Deybach JC, Puy H, Robreau AM, Lamoril J, Da Silva V, Grandchamp B, Nordmann Y: Mutations in the protoporphyrinogen oxidase gene in patients with variegate porphyria. Hum Mol Genet. 1996 Mar;5(3):407-10. 8852667
  11. Warnich L, Kotze MJ, Groenewald IM, Groenewald JZ, van Brakel MG, van Heerden CJ, de Villiers JN, van de Ven WJ, Schoenmakers EF, Taketani S, Retief AE: Identification of three mutations and associated haplotypes in the protoporphyrinogen oxidase gene in South African families with variegate porphyria. Hum Mol Genet. 1996 Jul;5(7):981-4. 8817334
  12. Meissner PN, Dailey TA, Hift RJ, Ziman M, Corrigall AV, Roberts AG, Meissner DM, Kirsch RE, Dailey HA: A R59W mutation in human protoporphyrinogen oxidase results in decreased enzyme activity and is prevalent in South Africans with variegate porphyria. Nat Genet. 1996 May;13(1):95-7. 8673113
  13. Frank J, Poh-Fitzpatrick MB, King LE Jr, Christiano AM: The genetic basis of "Scarsdale Gourmet Diet" variegate porphyria: a missense mutation in the protoporphyrinogen oxidase gene. Arch Dermatol Res. 1998 Aug;290(8):441-5. 9763307
  14. Frank J, Lam H, Zaider E, Poh-Fitzpatrick M, Christiano AM: Molecular basis of variegate porphyria: a missense mutation in the protoporphyrinogen oxidase gene. J Med Genet. 1998 Mar;35(3):244-7. 9541112
  15. Roberts AG, Puy H, Dailey TA, Morgan RR, Whatley SD, Dailey HA, Martasek P, Nordmann Y, Deybach JC, Elder GH: Molecular characterization of homozygous variegate porphyria. Hum Mol Genet. 1998 Nov;7(12):1921-5. 9811936
  16. Whatley SD, Puy H, Morgan RR, Robreau AM, Roberts AG, Nordmann Y, Elder GH, Deybach JC: Variegate porphyria in Western Europe: identification of PPOX gene mutations in 104 families, extent of allelic heterogeneity, and absence of correlation between phenotype and type of mutation. Am J Hum Genet. 1999 Oct;65(4):984-94. 10486317
  17. Maeda N, Horie Y, Sasaki Y, Adachi K, Nanba E, Nishida K, Saigo R, Nakagawa M, Kawasaki H, Kudo Y, Kondo M: Three novel mutations in the protoporphyrinogen oxidase gene in Japanese patients with variegate porphyria. Clin Biochem. 2000 Aug;33(6):495-500. 11074242
  18. De Siervi A, Parera VE, del C Batlle AM, Rossetti MV: Two new mutations (H106P and L178V) in the protoporphyrinogen oxidase gene in Argentinean patients with variegate porphyria. Hum Mutat. 2000 Dec;16(6):532. 11102990
  19. Corrigall AV, Hift RJ, Davids LM, Hancock V, Meissner D, Kirsch RE, Meissner PN: Homozygous variegate porphyria in South Africa: genotypic analysis in two cases. Mol Genet Metab. 2000 Apr;69(4):323-30. 10870850
  20. Kauppinen R, Timonen K, von und zu Fraunberg M, Laitinen E, Ahola H, Tenhunen R, Taketani S, Mustajoki P: Homozygous variegate porphyria: 20 y follow-up and characterization of molecular defect. J Invest Dermatol. 2001 Apr;116(4):610-3. 11286631
  21. Frank J, Jugert FK, Merk HF, Kalka K, Goerz G, Anderson K, Bickers DR, Poh-Fitzpatrick MB, Christiano AM: A spectrum of novel mutations in the protoporphyrinogen oxidase gene in 13 families with variegate porphyria. J Invest Dermatol. 2001 May;116(5):821-3. 11348478
  22. Corrigall AV, Hift RJ, Davids LM, Hancock V, Meissner D, Kirsch RE, Meissner PN: Identification of the first variegate porphyria mutation in an indigenous black South African and further evidence for heterogeneity in variegate porphyria. Mol Genet Metab. 2001 May;73(1):91-6. 11350188
  23. von und zu Fraunberg M, Tenhunen R, Kauppinen R: Expression and characterization of six mutations in the protoporphyrinogen oxidase gene among Finnish variegate porphyria patients. Mol Med. 2001 May;7(5):320-8. 11474578
  24. Rossi E, Chin CY, Beilby JP, Waso HF, Warnich L: Variegate porphyria in Western Australian Aboriginal patients. Intern Med J. 2002 Sep-Oct;32(9-10):445-50. 12380696
  25. Maneli MH, Corrigall AV, Klump HH, Davids LM, Kirsch RE, Meissner PN: Kinetic and physical characterisation of recombinant wild-type and mutant human protoporphyrinogen oxidases. Biochim Biophys Acta. 2003 Aug 21;1650(1-2):10-21. 12922165
  26. Wiman A, Harper P, Floderus Y: Nine novel mutations in the protoporphyrinogen oxidase gene in Swedish families with variegate porphyria. Clin Genet. 2003 Aug;64(2):122-30. 12859407
  27. D'Amato M, Bonuglia M, Barile S, Griso D, Macri A, Biolcati G: Genetic analysis of variegate porphyria (VP) in Italy: identification of six novel mutations in the protoporphyrinogen oxidase (PPOX) gene. Hum Mutat. 2003 Apr;21(4):448. 12655566
  28. Gouya L, Puy H, Robreau AM, Lyoumi S, Lamoril J, Da Silva V, Grandchamp B, Deybach JC: Modulation of penetrance by the wild-type allele in dominantly inherited erythropoietic protoporphyria and acute hepatic porphyrias. Hum Genet. 2004 Feb;114(3):256-62. Epub 2003 Dec 11. 14669009
  29. Poblete-Gutierrez P, Wolff C, Farias R, Frank J: A Chilean boy with severe photosensitivity and finger shortening: the first case of homozygous variegate porphyria in South America. Br J Dermatol. 2006 Feb;154(2):368-71. 16433813
  30. Davids LM, Corrigall AV, Meissner PN: Mitochondrial targeting of human protoporphyrinogen oxidase. Cell Biol Int. 2006 May;30(5):416-26. Epub 2006 Mar 6. 16621625
  31. Lecha M, Badenas C, Puig S, Orfila J, Mila M, To-Figueras J, Munoz C, Mercader P, Herrero C: Genetic studies in variegate porphyria in Spain. Identification of gene mutations and family study for carrier detection. J Eur Acad Dermatol Venereol. 2006 Sep;20(8):974-9. 16922948
  32. Schneider-Yin X, Minder EI: Swiss patients with variegate porphyria have unique mutations. Swiss Med Wkly. 2006 Aug 5;136(31-32):515-9. 16947091
  33. Ausenda S, Di Pierro E, Brancaleoni V, Besana V, Cappellini MD: Novel human pathological mutations. Gene symbol: PPOX. Disease: porphyria, variegate. Hum Genet. 2007 Nov;122(3-4):417. 18350656
  34. Rossetti MV, Granata BX, Giudice J, Parera VE, Batlle A: Genetic and biochemical studies in Argentinean patients with variegate porphyria. BMC Med Genet. 2008 Jun 20;9:54. doi: 10.1186/1471-2350-9-54. 18570668
  35. Ausenda S, Moriondo V, Marchini S, Besana V, Di Pierro E, Brancaleoni V, Ventura P, Rocchi E, Cappellini MD: Novel human pathological mutations. Gene symbol: PPOX. Disease: porphyria, variegate. Hum Genet. 2009 Apr;125(3):344. 19320019
  36. Mendez M, Granata BX, Jimenez MJ, Parera VE, Batlle A, de Salamanca RE, Rossetti MV: Functional Characterization of Five Protoporphyrinogen oxidase Missense Mutations Found in Argentinean Variegate Porphyria Patients. JIMD Rep. 2012;4:91-7. doi: 10.1007/8904_2011_77. Epub 2011 Dec 6. 23430901
  37. Pinder VA, Holden ST, Deshpande C, Siddiqui A, Mellerio JE, Wraige E, Powell AM: Homozygous variegate porphyria presenting with developmental and language delay in childhood. Clin Exp Dermatol. 2013 Oct;38(7):737-40. doi: 10.1111/ced.12071. 24073655