You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameChromaffin granule amine transporter
Synonyms
  • Solute carrier family 18 member 1
  • VAT1
  • Vesicular amine transporter 1
  • VMAT1
Gene NameSLC18A1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009591|Chromaffin granule amine transporter
MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSS
LHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISA
HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLS
TVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGL
LVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDP
YILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLA
NKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS
PPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
Number of residues525
Molecular Weight56256.71
Theoretical pINot Available
GO Classification
Functions
  • serotonin transmembrane transporter activity
  • drug transmembrane transporter activity
  • monoamine transmembrane transporter activity
Processes
  • monoamine transport
  • positive regulation of dopamine secretion
  • serotonin uptake
  • negative regulation of serotonin uptake
  • transmembrane transport
  • cellular response to lithium ion
Components
  • endoplasmic reticulum membrane
  • integral component of membrane
  • clathrin-sculpted monoamine transport vesicle membrane
General FunctionSerotonin transmembrane transporter activity
Specific FunctionInvolved in the transport of biogenic monoamines, such as serotonin, from the cytoplasm into the secretory vesicles of neuroendocrine and endocrine cells.
Pfam Domain Function
Transmembrane Regions22-42 139-158 168-188 198-218 228-250 257-279 300-319 336-360 366-386 398-418 423-443 449-470
GenBank Protein IDNot Available
UniProtKB IDP54219
UniProtKB Entry NameVMAT1_HUMAN
Cellular LocationCytoplasmic vesicle membrane
Gene sequence
>lcl|BSEQ0021405|Chromaffin granule amine transporter (SLC18A1)
ATGCTCCGGACCATTCTGGATGCTCCCCAGCGGTTGCTGAAGGAGGGGAGAGCGTCCCGG
CAGCTGGTGCTGGTGGTGGTATTCGTCGCTTTGCTCCTGGACAACATGCTGTTTACTGTG
GTGGTGCCAATTGTGCCCACCTTCCTATATGACATGGAGTTCAAAGAAGTCAACTCTTCT
CTGCACCTCGGCCATGCCGGAAGTTCCCCACATGCCCTCGCCTCTCCTGCCTTTTCCACC
ATCTTCTCCTTCTTCAACAACAACACCGTGGCTGTTGAAGAAAGCGTACCTAGTGGAATA
GCATGGATGAATGACACTGCCAGCACCATCCCACCTCCAGCCACTGAAGCCATCTCAGCT
CATAAAAACAACTGCTTGCAAGGCACAGGTTTCTTGGAGGAAGAGATTACCCGGGTCGGG
GTTCTGTTTGCTTCAAAGGCTGTGATGCAACTTCTGGTCAACCCATTCGTGGGCCCTCTC
ACCAACAGGATTGGATATCATATCCCCATGTTTGCTGGCTTTGTTATCATGTTTCTCTCC
ACAGTTATGTTTGCTTTTTCTGGGACCTATACTCTACTCTTTGTGGCCCGAACCCTTCAA
GGCATTGGATCTTCATTTTCATCTGTTGCAGGTCTTGGAATGCTGGCCAGTGTCTACACT
GATGACCATGAGAGAGGACGAGCCATGGGAACTGCTCTGGGGGGCCTGGCCTTGGGGTTG
CTGGTGGGAGCTCCCTTTGGAAGTGTAATGTACGAGTTTGTTGGGAAGTCTGCACCCTTC
CTCATCCTGGCCTTCCTGGCACTACTGGATGGAGCACTCCAGCTTTGCATCCTACAGCCT
TCCAAAGTCTCTCCTGAGAGTGCCAAGGGGACTCCCCTCTTTATGCTTCTCAAAGACCCT
TACATCCTGGTGGCTGCAGGGTCCATCTGCTTTGCCAACATGGGGGTGGCCATCCTGGAG
CCCACACTGCCCATCTGGATGATGCAGACCATGTGCTCCCCCAAGTGGCAGCTGGGTCTA
GCTTTCTTGCCTGCCAGTGTGTCCTACCTCATTGGCACCAACCTCTTTGGTGTGTTGGCC
AACAAGATGGGTCGGTGGCTGTGTTCCCTAATCGGGATGCTGGTAGTAGGTACCAGCTTG
CTCTGTGTTCCTCTGGCTCACAATATTTTTGGTCTCATTGGCCCCAATGCAGGGCTTGGC
CTTGCCATAGGCATGGTGGATTCTTCTATGATGCCCATCATGGGGCACCTGGTGGATCTA
CGCCACACCTCGGTGTATGGGAGTGTCTACGCCATCGCTGATGTGGCTTTTTGCATGGGC
TTTGCTATAGGTCCATCCACCGGTGGTGCCATTGTAAAGGCCATCGGTTTTCCCTGGCTC
ATGGTCATCACTGGGGTCATCAACATCGTCTATGCTCCACTCTGCTACTACCTGCGGAGC
CCCCCGGCAAAGGAAGAGAAGCTTGCTATTCTGAGTCAGGACTGCCCCATGGAGACCCGG
ATGTATGCAACCCAGAAGCCCACGAAGGAATTTCCTCTGGGGGAGGACAGTGATGAGGAG
CCTGACCATGAGGAGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:10934
Chromosome Location8
LocusNot Available
References
  1. Erickson JD, Schafer MK, Bonner TI, Eiden LE, Weihe E: Distinct pharmacological properties and distribution in neurons and endocrine cells of two isoforms of the human vesicular monoamine transporter. Proc Natl Acad Sci U S A. 1996 May 14;93(10):5166-71. 8643547
  2. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. 16421571
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Essand M, Vikman S, Grawe J, Gedda L, Hellberg C, Oberg K, Totterman TH, Giandomenico V: Identification and characterization of a novel splicing variant of vesicular monoamine transporter 1. J Mol Endocrinol. 2005 Dec;35(3):489-501. 16326835