ADP-ribosylation factor 6

NameADP-ribosylation factor 6
SynonymsNot Available
Gene NameARF6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019545|ADP-ribosylation factor 6
MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS
Number of residues175
Molecular Weight20082.01
Theoretical pI9.32
GO Classification
Functions
  • GTP binding
  • GTPase activity
  • thioesterase binding
Processes
  • negative regulation of receptor-mediated endocytosis
  • positive regulation of actin filament polymerization
  • protein transport
  • regulation of filopodium assembly
  • myeloid cell apoptotic process
  • ruffle organization
  • small GTPase mediated signal transduction
  • protein localization to endosome
  • protein localization to cell surface
  • cell division
  • regulation of Rac protein signal transduction
  • cell cycle
  • cortical actin cytoskeleton organization
  • vesicle-mediated transport
  • positive regulation of establishment of protein localization to plasma membrane
  • hepatocyte apoptotic process
  • regulation of dendritic spine development
  • movement of cell or subcellular component
  • negative regulation of dendrite development
  • cell adhesion
  • establishment of epithelial cell polarity
  • liver development
Components
  • early endosome
  • cell cortex
  • plasma membrane
  • midbody
  • ruffle
  • Golgi apparatus
  • recycling endosome membrane
  • extracellular exosome
  • cleavage furrow
  • myelin sheath
  • endosome
  • filopodium membrane
  • endocytic vesicle
  • focal adhesion
  • membrane
General FunctionThioesterase binding
Specific FunctionGTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. Required for normal completion of mitotic cytokinesis. Plays a role in the reorganization of the actin cytoskeleton and the formation of stress fibers. May also modulate vesicle budding and uncoating within the Golgi apparatus. Involved in the regulation of dendritic spine development, contributing to the regulation of dendritic branching and filopodia extension. Functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID178989
UniProtKB IDP62330
UniProtKB Entry NameARF6_HUMAN
Cellular LocationGolgi apparatus
Gene sequence
>lcl|BSEQ0019546|ADP-ribosylation factor 6 (ARF6)
ATGGGGAAGGTGCTATCCAAAATCTTCGGGAACAAGGAAATGCGGATCCTCATGTTGGGC
CTGGACGCGGCCGGCAAGACAACAATCCTGTACAAGTTGAAGCTGGGCCAGTCGGTGACC
ACCATTCCCACTGTGGGTTTCAACGTGGAGACGGTGACTTACAAAAATGTCAAGTTCAAC
GTATGGGATGTGGGCGGCCAGGACAAGATCCGGCCGCTCTGGCGGCATTACTACACTGGG
ACCCAAGGTCTCATCTTCGTAGTGGACTGCGCCGACCGCGACCGCATCGATGAGGCTCGC
CAGGAGCTGCACCGCATTATCAATGACCGGGAGATGAGGGACGCCATAATCCTCATCTTC
GCCAACAAGCAGGACCTGCCCGATGCCATGAAACCCCACGAGATCCAGGAGAAACTGGGC
CTGACCCGGATTCGGGACAGGAACTGGTATGTGCAGCCCTCCTGTGCCACCTCAGGGGAC
GGACTCTATGAGGGGCTCACATGGTTAACCTCTAACTACAAATCTTAA
GenBank Gene IDM57763
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:659
Chromosome Location14
Locus14q21.3
References
  1. Tsuchiya M, Price SR, Tsai SC, Moss J, Vaughan M: Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells. J Biol Chem. 1991 Feb 15;266(5):2772-7. 1993656
  2. Lebeda RA, Johnson SK, Stewart MI, Haun RS: Sequence, genomic organization, and expression of the human ADP-ribosylation factor 6 (ARF6) gene: a class III ARF. DNA Cell Biol. 2003 Nov;22(11):737-41. 14659046
  3. Mao M, Fu G, Wu JS, Zhang QH, Zhou J, Kan LX, Huang QH, He KL, Gu BW, Han ZG, Shen Y, Gu J, Yu YP, Xu SH, Wang YX, Chen SJ, Chen Z: Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning. Proc Natl Acad Sci U S A. 1998 Jul 7;95(14):8175-80. 9653160
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. D'Souza-Schorey C, Stahl PD: Myristoylation is required for the intracellular localization and endocytic function of ARF6. Exp Cell Res. 1995 Nov;221(1):153-9. 7589240
  7. Jackson TR, Brown FD, Nie Z, Miura K, Foroni L, Sun J, Hsu VW, Donaldson JG, Randazzo PA: ACAPs are arf6 GTPase-activating proteins that function in the cell periphery. J Cell Biol. 2000 Oct 30;151(3):627-38. 11062263
  8. Krauss M, Kinuta M, Wenk MR, De Camilli P, Takei K, Haucke V: ARF6 stimulates clathrin/AP-2 recruitment to synaptic membranes by activating phosphatidylinositol phosphate kinase type Igamma. J Cell Biol. 2003 Jul 7;162(1):113-24. 12847086
  9. Martinu L, Masuda-Robens JM, Robertson SE, Santy LC, Casanova JE, Chou MM: The TBC (Tre-2/Bub2/Cdc16) domain protein TRE17 regulates plasma membrane-endosomal trafficking through activation of Arf6. Mol Cell Biol. 2004 Nov;24(22):9752-62. 15509780
  10. Gauthier-Campbell C, Bredt DS, Murphy TH, El-Husseini Ael-D: Regulation of dendritic branching and filopodia formation in hippocampal neurons by specific acylated protein motifs. Mol Biol Cell. 2004 May;15(5):2205-17. Epub 2004 Feb 20. 14978216
  11. Fielding AB, Schonteich E, Matheson J, Wilson G, Yu X, Hickson GR, Srivastava S, Baldwin SA, Prekeris R, Gould GW: Rab11-FIP3 and FIP4 interact with Arf6 and the exocyst to control membrane traffic in cytokinesis. EMBO J. 2005 Oct 5;24(19):3389-99. Epub 2005 Sep 8. 16148947
  12. Garcia-Gonzalo FR, Bartrons R, Ventura F, Rosa JL: Requirement of phosphatidylinositol-4,5-bisphosphate for HERC1-mediated guanine nucleotide release from ARF proteins. FEBS Lett. 2005 Jan 17;579(2):343-8. 15642342
  13. Dubois T, Paleotti O, Mironov AA, Fraisier V, Stradal TE, De Matteis MA, Franco M, Chavrier P: Golgi-localized GAP for Cdc42 functions downstream of ARF1 to control Arp2/3 complex and F-actin dynamics. Nat Cell Biol. 2005 Apr;7(4):353-64. Epub 2005 Mar 27. 15793564
  14. Fang Z, Miao Y, Ding X, Deng H, Liu S, Wang F, Zhou R, Watson C, Fu C, Hu Q, Lillard JW Jr, Powell M, Chen Y, Forte JG, Yao X: Proteomic identification and functional characterization of a novel ARF6 GTPase-activating protein, ACAP4. Mol Cell Proteomics. 2006 Aug;5(8):1437-49. Epub 2006 May 30. 16737952
  15. Shiba T, Koga H, Shin HW, Kawasaki M, Kato R, Nakayama K, Wakatsuki S: Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proc Natl Acad Sci U S A. 2006 Oct 17;103(42):15416-21. Epub 2006 Oct 9. 17030804
  16. Hofmann I, Thompson A, Sanderson CM, Munro S: The Arl4 family of small G proteins can recruit the cytohesin Arf6 exchange factors to the plasma membrane. Curr Biol. 2007 Apr 17;17(8):711-6. Epub 2007 Mar 29. 17398095
  17. Schonteich E, Pilli M, Simon GC, Matern HT, Junutula JR, Sentz D, Holmes RK, Prekeris R: Molecular characterization of Rab11-FIP3 binding to ARF GTPases. Eur J Cell Biol. 2007 Aug;86(8):417-31. Epub 2007 Jul 12. 17628206
  18. Haynes LP, Sherwood MW, Dolman NJ, Burgoyne RD: Specificity, promiscuity and localization of ARF protein interactions with NCS-1 and phosphatidylinositol-4 kinase-III beta. Traffic. 2007 Aug;8(8):1080-92. Epub 2007 Jun 6. 17555535
  19. Ha VL, Bharti S, Inoue H, Vass WC, Campa F, Nie Z, de Gramont A, Ward Y, Randazzo PA: ASAP3 is a focal adhesion-associated Arf GAP that functions in cell migration and invasion. J Biol Chem. 2008 May 30;283(22):14915-26. doi: 10.1074/jbc.M709717200. Epub 2008 Apr 8. 18400762
  20. Falace A, Filipello F, La Padula V, Vanni N, Madia F, De Pietri Tonelli D, de Falco FA, Striano P, Dagna Bricarelli F, Minetti C, Benfenati F, Fassio A, Zara F: TBC1D24, an ARF6-interacting protein, is mutated in familial infantile myoclonic epilepsy. Am J Hum Genet. 2010 Sep 10;87(3):365-70. doi: 10.1016/j.ajhg.2010.07.020. Epub 2010 Aug 19. 20727515
  21. Wan T, Liu T, Zhang H, Tang S, Min W: AIP1 functions as Arf6-GAP to negatively regulate TLR4 signaling. J Biol Chem. 2010 Feb 5;285(6):3750-7. doi: 10.1074/jbc.M109.069385. Epub 2009 Nov 30. 19948740
  22. Gorbea C, Pratt G, Ustrell V, Bell R, Sahasrabudhe S, Hughes RE, Rechsteiner M: A protein interaction network for Ecm29 links the 26 S proteasome to molecular motors and endosomal components. J Biol Chem. 2010 Oct 8;285(41):31616-33. doi: 10.1074/jbc.M110.154120. Epub 2010 Aug 3. 20682791
  23. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  24. Rahajeng J, Giridharan SS, Cai B, Naslavsky N, Caplan S: MICAL-L1 is a tubular endosomal membrane hub that connects Rab35 and Arf6 with Rab8a. Traffic. 2012 Jan;13(1):82-93. doi: 10.1111/j.1600-0854.2011.01294.x. Epub 2011 Oct 24. 21951725
  25. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  26. Thinon E, Serwa RA, Broncel M, Brannigan JA, Brassat U, Wright MH, Heal WP, Wilkinson AJ, Mann DJ, Tate EW: Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nat Commun. 2014 Sep 26;5:4919. doi: 10.1038/ncomms5919. 25255805
  27. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712
  28. Menetrey J, Macia E, Pasqualato S, Franco M, Cherfils J: Structure of Arf6-GDP suggests a basis for guanine nucleotide exchange factors specificity. Nat Struct Biol. 2000 Jun;7(6):466-9. 10881192
  29. Pasqualato S, Menetrey J, Franco M, Cherfils J: The structural GDP/GTP cycle of human Arf6. EMBO Rep. 2001 Mar;2(3):234-8. 11266366
  30. O'Neal CJ, Jobling MG, Holmes RK, Hol WG: Structural basis for the activation of cholera toxin by human ARF6-GTP. Science. 2005 Aug 12;309(5737):1093-6. 16099990
  31. Gizachew D, Oswald R: NMR structural studies of the myristoylated N-terminus of ADP ribosylation factor 6 (Arf6). FEBS Lett. 2006 Jul 24;580(17):4296-301. Epub 2006 Jul 7. 16839550
  32. Isabet T, Montagnac G, Regazzoni K, Raynal B, El Khadali F, England P, Franco M, Chavrier P, Houdusse A, Menetrey J: The structural basis of Arf effector specificity: the crystal structure of ARF6 in a complex with JIP4. EMBO J. 2009 Sep 16;28(18):2835-45. doi: 10.1038/emboj.2009.209. Epub 2009 Jul 30. 19644450
  33. Ismail SA, Vetter IR, Sot B, Wittinghofer A: The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism. Cell. 2010 May 28;141(5):812-21. doi: 10.1016/j.cell.2010.03.051. 20510928
  34. Selyunin AS, Sutton SE, Weigele BA, Reddick LE, Orchard RC, Bresson SM, Tomchick DR, Alto NM: The assembly of a GTPase-kinase signalling complex by a bacterial catalytic scaffold. Nature. 2011 Jan 6;469(7328):107-11. doi: 10.1038/nature09593. Epub 2010 Dec 19. 21170023
  35. Dong N, Zhu Y, Lu Q, Hu L, Zheng Y, Shao F: Structurally distinct bacterial TBC-like GAPs link Arf GTPase to Rab1 inactivation to counteract host defenses. Cell. 2012 Aug 31;150(5):1029-41. doi: 10.1016/j.cell.2012.06.050. 22939626
  36. Malaby AW, van den Berg B, Lambright DG: Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors. Proc Natl Acad Sci U S A. 2013 Aug 27;110(35):14213-8. doi: 10.1073/pnas.1301883110. Epub 2013 Aug 12. 23940353