You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameDNA-directed RNA polymerase II subunit RPB7
Synonyms
  • DNA-directed RNA polymerase II subunit G
  • RNA polymerase II 19 kDa subunit
  • RNA polymerase II subunit B7
  • RPB19
  • RPB7
Gene NamePOLR2G
OrganismHuman
Amino acid sequence
>lcl|BSEQ0019705|DNA-directed RNA polymerase II subunit RPB7
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
Number of residues172
Molecular Weight19294.195
Theoretical pINot Available
GO Classification
Functions
  • single-stranded DNA binding
  • single-stranded RNA binding
  • translation initiation factor binding
  • DNA-directed RNA polymerase activity
Processes
  • mRNA splicing, via spliceosome
  • nucleotide-excision repair
  • piRNA metabolic process
  • positive regulation of translational initiation
  • transcription from RNA polymerase II promoter
  • positive regulation of viral transcription
  • RNA splicing
  • gene expression
  • transcription elongation from RNA polymerase II promoter
  • transcription initiation from RNA polymerase II promoter
  • nuclear-transcribed mRNA catabolic process, exonucleolytic
  • apoptotic process
  • positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
  • somatic stem cell population maintenance
  • transcription-coupled nucleotide-excision repair
  • viral process
  • 7-methylguanosine mRNA capping
  • gene silencing by RNA
  • DNA repair
Components
  • DNA-directed RNA polymerase II, core complex
  • nucleoplasm
  • cytoplasmic mRNA processing body
  • nucleus
General FunctionTranslation initiation factor binding
Specific FunctionDNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB7 is part of a subcomplex with RPB4 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double-stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA (By similarity). Binds RNA.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDP62487
UniProtKB Entry NameRPB7_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0019706|DNA-directed RNA polymerase II subunit RPB7 (POLR2G)
ATGTTCTACCATATCTCCCTAGAGCACGAAATCCTGCTGCACCCGCGCTACTTCGGCCCC
AACTTGCTCAACACGGTGAAGCAGAAGCTCTTCACCGAGGTGGAGGGGACCTGCACAGGG
AAGTATGGCTTTGTAATTGCTGTCACCACCATTGACAATATTGGTGCTGGTGTGATCCAG
CCAGGCCGAGGCTTTGTCCTTTATCCAGTTAAGTACAAGGCCATTGTTTTCCGGCCATTT
AAAGGGGAGGTCGTGGATGCTGTTGTCACTCAGGTCAACAAGGTTGGACTCTTCACAGAA
ATTGGGCCCATGTCTTGCTTCATCTCTCGACATTCCATCCCTTCAGAGATGGAGTTTGAT
CCTAACTCCAACCCACCATGTTACAAGACAATGGATGAGGATATTGTGATTCAGCAGGAC
GATGAGATCCGCTTAAAGATTGTGGGGACCCGTGTGGACAAGAATGACATTTTTGCTATT
GGCTCCCTGATGGACGATTACTTGGGGCTTGTAAGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9194
Chromosome Location11
LocusNot Available
References
  1. Khazak V, Sadhale PP, Woychik NA, Brent R, Golemis EA: Human RNA polymerase II subunit hsRPB7 functions in yeast and influences stress survival and cell morphology. Mol Biol Cell. 1995 Jul;6(7):759-75. 7579693
  2. Schoen TJ, Chandrasekharappa SC, Guru SC, Mazuruk K, Chader GJ, Rodriguez IR: Human gene for the RNA polymerase II seventh subunit (hsRPB7): structure, expression and chromosomal localization. Biochim Biophys Acta. 1997 Jul 17;1353(1):39-49. 9256063
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Kershnar E, Wu SY, Chiang CM: Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes. J Biol Chem. 1998 Dec 18;273(51):34444-53. 9852112
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  7. Meka H, Werner F, Cordell SC, Onesti S, Brick P: Crystal structure and RNA binding of the Rpb4/Rpb7 subunits of human RNA polymerase II. Nucleic Acids Res. 2005 Nov 10;33(19):6435-44. Print 2005. 16282592