You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSerine/threonine-protein phosphatase 2A catalytic subunit beta isoform
Synonyms
  • 3.1.3.16
  • PP2A-beta
Gene NamePPP2CB
OrganismHuman
Amino acid sequence
>lcl|BSEQ0011673|Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
Number of residues309
Molecular Weight35574.85
Theoretical pI5.08
GO Classification
Functions
  • protein serine/threonine phosphatase activity
  • metal ion binding
Processes
  • response to hydrogen peroxide
  • fibroblast growth factor receptor signaling pathway
  • regulation of gene expression
  • protein dephosphorylation
  • response to endoplasmic reticulum stress
  • apoptotic mitochondrial changes
  • proteasome-mediated ubiquitin-dependent protein catabolic process
  • negative regulation of Ras protein signal transduction
  • response to antibiotic
Components
  • extracellular exosome
  • spindle pole
  • chromosome, centromeric region
  • nucleus
  • protein phosphatase type 2A complex
  • cytosol
General FunctionProtein serine/threonine phosphatase activity
Specific FunctionPP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID35581
UniProtKB IDP62714
UniProtKB Entry NamePP2AB_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0011674|Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB)
ATGGACGACAAGGCGTTCACCAAGGAGCTGGACCAGTGGGTCGAGCAGCTGAACGAGTGT
AAGCAGCTGAACGAGAACCAAGTGCGGACGCTGTGCGAGAAGGCAAAGGAAATTTTAACA
AAAGAATCAAATGTGCAAGAGGTTCGTTGCCCTGTTACTGTCTGTGGAGATGTGCATGGT
CAATTTCATGATCTTATGGAACTCTTTAGAATTGGTGGAAAATCACCGGATACAAACTAC
TTATTCATGGGTGACTATGTAGACAGAGGATATTATTCAGTGGAGACTGTGACTCTTCTT
GTAGCATTAAAGGTGCGTTATCCAGAACGCATTACAATATTGAGAGGAAATCACGAAAGC
CGACAAATTACCCAAGTATATGGCTTTTATGATGAATGTCTGCGAAAGTATGGGAATGCC
AACGTTTGGAAATATTTTACAGATCTCTTTGATTATCTTCCACTTACAGCTTTAGTAGAT
GGACAGATATTCTGCCTCCATGGTGGCCTCTCTCCATCCATAGACACACTGGATCATATA
AGAGCCCTGGATCGTTTACAGGAAGTTCCACATGAGGGCCCAATGTGTGATCTGTTATGG
TCAGATCCAGATGATCGTGGTGGATGGGGTATTTCACCACGTGGTGCTGGCTACACATTT
GGACAAGACATTTCTGAAACCTTTAACCATGCCAATGGTCTCACACTGGTTTCTCGTGCC
CACCAGCTTGTAATGGAGGGATACAATTGGTGTCATGATCGGAATGTGGTTACCATTTTC
AGTGCACCCAATTACTGTTATCGTTGTGGGAACCAGGCTGCTATCATGGAATTAGATGAC
ACTTTAAAATATTCCTTCCTTCAATTTGACCCAGCGCCTCGTCGTGGTGAGCCTCATGTT
ACACGGCGCACCCCAGACTACTTCCTATAA
GenBank Gene IDX12656
GeneCard IDNot Available
GenAtlas IDPPP2CB
HGNC IDHGNC:9300
Chromosome Location8
Locus8p12
References
  1. Hemmings BA, Wernet W, Mayer R, Maurer F, Hofsteenge J, Stone SR: The nucleotide sequence of the cDNA encoding the human lung protein phosphatase 2A beta catalytic subunit. Nucleic Acids Res. 1988 Dec 9;16(23):11366. 2849765
  2. Arino J, Woon CW, Brautigan DL, Miller TB Jr, Johnson GL: Human liver phosphatase 2A: cDNA and amino acid sequence of two catalytic subunit isotypes. Proc Natl Acad Sci U S A. 1988 Jun;85(12):4252-6. 2837763
  3. Khew-Goodall Y, Mayer RE, Maurer F, Stone SR, Hemmings BA: Structure and transcriptional regulation of protein phosphatase 2A catalytic subunit genes. Biochemistry. 1991 Jan 8;30(1):89-97. 1846293
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Virshup DM, Kauffman MG, Kelly TJ: Activation of SV40 DNA replication in vitro by cellular protein phosphatase 2A. EMBO J. 1989 Dec 1;8(12):3891-8. 2555176
  6. Pallas DC, Shahrik LK, Martin BL, Jaspers S, Miller TB, Brautigan DL, Roberts TM: Polyoma small and middle T antigens and SV40 small t antigen form stable complexes with protein phosphatase 2A. Cell. 1990 Jan 12;60(1):167-76. 2153055
  7. Favre B, Zolnierowicz S, Turowski P, Hemmings BA: The catalytic subunit of protein phosphatase 2A is carboxyl-methylated in vivo. J Biol Chem. 1994 Jun 10;269(23):16311-7. 8206937
  8. Ogris E, Du X, Nelson KC, Mak EK, Yu XX, Lane WS, Pallas DC: A protein phosphatase methylesterase (PME-1) is one of several novel proteins stably associating with two inactive mutants of protein phosphatase 2A. J Biol Chem. 1999 May 14;274(20):14382-91. 10318862
  9. Kitajima TS, Sakuno T, Ishiguro K, Iemura S, Natsume T, Kawashima SA, Watanabe Y: Shugoshin collaborates with protein phosphatase 2A to protect cohesin. Nature. 2006 May 4;441(7089):46-52. Epub 2006 Mar 15. 16541025
  10. Goudreault M, D'Ambrosio LM, Kean MJ, Mullin MJ, Larsen BG, Sanchez A, Chaudhry S, Chen GI, Sicheri F, Nesvizhskii AI, Aebersold R, Raught B, Gingras AC: A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein. Mol Cell Proteomics. 2009 Jan;8(1):157-71. doi: 10.1074/mcp.M800266-MCP200. Epub 2008 Sep 8. 18782753
  11. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460