You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameVoltage-dependent calcium channel gamma-7 subunit
Synonyms
  • Neuronal voltage-gated calcium channel gamma-7 subunit
  • TARP gamma-7
  • Transmembrane AMPAR regulatory protein gamma-7
Gene NameCACNG7
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013461|Voltage-dependent calcium channel gamma-7 subunit
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
Number of residues275
Molecular Weight31002.29
Theoretical pINot Available
GO Classification
Functions
  • channel regulator activity
  • voltage-gated calcium channel activity
Processes
  • calcium ion transport
  • transmission of nerve impulse
  • calcium ion transmembrane transport
  • regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity
Components
  • voltage-gated calcium channel complex
  • AMPA glutamate receptor complex
General FunctionVoltage-gated calcium channel activity
Specific FunctionRegulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Displays subunit-specific AMPA receptor regulation. Shows specificity only for GRIA1 and GRIA2. Thought to stabilize the calcium channel in an inactivated (closed) state.
Pfam Domain Function
Transmembrane Regions8-28 103-123 129-149 179-199
GenBank Protein IDNot Available
UniProtKB IDP62955
UniProtKB Entry NameCCG7_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013462|Voltage-dependent calcium channel gamma-7 subunit (CACNG7)
ATGAGTCACTGCAGCAGCCGCGCCCTGACCCTGCTGAGCAGCGTGTTTGGTGCGTGTGGC
CTGCTCCTGGTAGGCATCGCGGTCAGCACTGACTACTGGCTGTACATGGAAGAAGGCACA
GTGCTACCGCAGAACCAGACCACCGAGGTCAAGATGGCCCTGCACGCCGGCCTCTGGCGA
GTCTGCTTCTTTGCAGGTCGGGAGAAAGGTCGCTGTGTGGCCTCAGAATATTTTCTTGAA
CCGGAGATCAATTTGGTGACGGAAAACACGGAGAATATTCTGAAGACAGTGCGCACGGCC
ACCCCCTTCCCCATGGTCAGCCTCTTCCTCGTGTTCACGGCCTTCGTCATCAGCAACATC
GGCCACATCCGCCCGCAGAGGACCATTCTGGCTTTTGTCTCTGGCATCTTCTTCATACTA
TCGGGCCTCTCCTTGGTGGTGGGCTTGGTTCTTTACATCTCCAGCATCAACGACGAGGTC
ATGAACAGGCCCAGCAGCTCTGAGCAGTATTTTCATTATCGCTACGGGTGGTCTTTTGCC
TTCGCCGCTTCCTCCTTCCTACTCAAAGAGGGGGCCGGCGTGATGTCCGTGTACCTGTTC
ACCAAGCGCTACGCGGAGGAGGAGATGTACCGTCCACACCCGGCCTTCTACCGCCCGCGT
CTCAGCGACTGCTCCGACTACTCGGGCCAGTTCCTGCAGCCCGAGGCGTGGCGCCGCGGC
CGGAGCCCCTCCGACATCTCCAGCGACGTGTCCATCCAAATGACGCAGAACTACCCTCCC
GCCATCAAGTACCCGGACCACCTGCACATCTCCACCTCGCCCTGCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:13626
Chromosome Location19
LocusNot Available
References
  1. Burgess DL, Gefrides LA, Foreman PJ, Noebels JL: A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family. Genomics. 2001 Feb 1;71(3):339-50. 11170751
  2. Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. 11738816
  3. Moss FJ, Viard P, Davies A, Bertaso F, Page KM, Graham A, Canti C, Plumpton M, Plumpton C, Clare JJ, Dolphin AC: The novel product of a five-exon stargazin-related gene abolishes Ca(V)2.2 calcium channel expression. EMBO J. 2002 Apr 2;21(7):1514-23. 11927536
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Kato AS, Gill MB, Ho MT, Yu H, Tu Y, Siuda ER, Wang H, Qian YW, Nisenbaum ES, Tomita S, Bredt DS: Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins. Neuron. 2010 Dec 22;68(6):1082-96. doi: 10.1016/j.neuron.2010.11.026. 21172611