You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameATP-dependent 6-phosphofructokinase, platelet type
Synonyms
  • 2.7.1.11
  • 6-phosphofructokinase type C
  • ATP-PFK
  • PFK-C
  • PFKF
  • Phosphofructo-1-kinase isozyme C
  • Phosphohexokinase
Gene NamePFKP
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008944|ATP-dependent 6-phosphofructokinase, platelet type
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMEC
VQMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGA
PAAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTK
RVLPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSICVL
GISKRNVIFQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQ
PWSV
Number of residues784
Molecular Weight85595.405
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
  • metal ion binding
  • 6-phosphofructokinase activity
  • protein complex binding
Processes
  • mitophagy in response to mitochondrial depolarization
  • fructose 6-phosphate metabolic process
  • small molecule metabolic process
  • carbohydrate metabolic process
  • glucose metabolic process
  • canonical glycolysis
Components
  • membrane
  • nucleus
  • cytosol
  • extracellular exosome
General FunctionProtein complex binding
Specific FunctionCatalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ01813
UniProtKB Entry NamePFKAP_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013522|ATP-dependent 6-phosphofructokinase, platelet type (PFKP)
ATGTGCGGGTATGAACGCTGCCGTCCGTGCCGTGGTGCGCATGGGTATCTACGTGGGGGC
CAAGGTGTACTTCATCTACGAGGGCTACCAGGGCATGGTGGACGGAGGCTCAAACATCGC
AGAGGCCGACTGGGAGAGTGTCTCCAGCATCCTGCAAGTGGTGCTGTAAGGGGTGACTGG
AGGGAGAAGCCTGGCTGCTGGTCACACCGCTTCCCTTGTCCTGGCCGGCATGCTCTGGTG
GGCGGGACGATCATTGGCAGTGCGCGGTGCCAGGCCTTCCGCACGCGGGAAGGCCGCCTG
AAGGCTGCTTGCAACCTGCTGCAGCGCGGCATCACCAACCTGTGTGTGATCGGCGGGGAC
GGGAGCCTCACCGGGGCCAACCTCTTCCGGAAGGAGTGGAGTGGGCTGCTGGAGGAGCTG
GCCAGGAACGGCCAGATCGATAAGGAGGCCGTGCAGAAGTACGCCTACCTCAACGTGGTG
GGCATGGTGGGCTCCATCGACAATGATTTCTGCGGCACCGACATGACCATCGGCACGGAC
TCCGCCCTGCACAGGATCATCGAGGTCGTCGACGCCATCATGACCACGGCCCAGAGCCAC
CAGAGGACCTTCGTTCTGGAGGTGATGGGACGACACTGTGGGTACCTGGCCCTGGTGAGT
GCCTTGGCCTGCGGTGCGGACTGGGTGTTCCTTCCAGAATCTCCACCAGAGGAAGGCTGG
GAGGAGCAGATGTGTGTCAAACTCTCGGAGAACCGTGCCCGGAAAAAAAGGCTGAATATT
ATTATTGTGGCTGAAGGAGCAATTGATACCCAAAATAAACCCATCACCTCTGAGAAAATC
AAAGAGCTTGTCGTCACGCAGCTGGGCTATGACACACGTGTGACCATCCTCGGGCACGTG
CAGAGAGGAGGGACCCCTTCGGCATTCGACAGGATCTTGGCCAGCCGCATGGGAGTGGAG
GCAGTCATCGCCTTGCTAGAGGCCACCCCGGACACCCCAGCTTGCGTCGTGTCACTGAAC
GGGAACCACGCCGTGCGCCTGCCGCTGATGGAGTGCGTGCAGATGACTCAGGATGTGCAG
AAGGCGATGGACGAGAGGAGATTTCAAGATGCGGTTCGACTCCGAGGGAGGAGCTTTGCG
GGCAACCTGAACACCTACAAGCGACTTGCCATCAAGCTGCCGGATGATCAGATCCCAAAG
ACCAATTGCAACGTAGCTGTCATCAACGTGGGGGCACCCGCGGCTGGGATGAACGCAGCC
GTACGCTCAGCTGTGCGCGTGGGCATTGCCGACGGCCACAGGATGCTCGCCATCTATGAT
GGCTTTGACGGCTTCGCCAAGGGCCAGATCAAAGAAATCGGCTGGACAGATGTCGGGGGC
TGGACCGGCCAAGGAGGCTCCATTCTTGGGACAAAACGCGTTCTCCCGGGGAAGTACTTG
GAAGAGATCGCCACACAGATGCGCACGCACAGCATCAACGCGCTGCTGATCATCGGTGGA
TTCGAGGCCTACCTGGGACTCCTGGAGCTGTCAGCCGCCCGGGAGAAGCACGAGGAGTTC
TGTGTCCCCATGGTCATGGTTCCCGCTACTGTGTCCAACAATGTGCCGGGTTCCGATTTC
AGCATCGGGGCAGACACCGCCCTGAACACTATCACCGACACCTGCGACCGCATCAAGCAG
TCCGCCAGCGGAACCAAGCGGCGCGTGTTCATCATCGAGACCATGGGCGGCTACTGTGGC
TACCTGGCCAACATGGGGGGGCTCGCGGCCGGAGCTGATGCCGCATACATTTTCGAAGAG
CCCTTCGACATCAGGGATCTGCAGTCCAACGTGGAGCACCTGACGGAGAAAATGAAGACC
ACCATCCAGAGAGGCCTTGTGCTCAGAAATGAGAGCTGCAGTGAAAACTACACCACCGAC
TTCATTTACCAGCTGTATTCAGAAGAGGGCAAAGGCGTGTTTGACTGCAGGAAGAACGTG
CTGGGTCACATGCAGCAGGGTGGGGCACCCTCTCCATTTGATAGAAACTTTGGAACCAAA
ATCTCTGCCAGAGCTATGGAGTGGATCACTGCAAAACTCAAGGAGGCCCGGGGCAGAGGA
AAAAAATTTACCACCGATGATTCCATTTGTGTGCTGGGAATAAGCAAAAGAAACGTTATT
TTTCAACCTGTGGCAGAGCTGAAGAAGCAAACGGATTTTGAGCACAGGATTCCCAAAGAA
CAGTGGTGGCTCAAGCTACGGCCCCTCATGAAAATCCTGGCCAAGTACAAGGCCAGCTAT
GACGTGTCGGACTCAGGCCAGCTGGAACATGTGCAGCCCTGGAGTGTCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:8878
Chromosome Location10
LocusNot Available
References
  1. Eto K, Sakura H, Yasuda K, Hayakawa T, Kawasaki E, Moriuchi R, Nagataki S, Yazaki Y, Kadowaki T: Cloning of a complete protein-coding sequence of human platelet-type phosphofructokinase isozyme from pancreatic islet. Biochem Biophys Res Commun. 1994 Feb 15;198(3):990-8. 8117307
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Simpson CJ, Fothergill-Gilmore LA: Isolation and sequence of a cDNA encoding human platelet phosphofructokinase. Biochem Biophys Res Commun. 1991 Oct 15;180(1):197-203. 1834056
  6. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. 15592455
  7. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. 16964243
  8. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. 18691976
  9. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  10. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  11. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  12. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  13. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  14. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  15. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692