Cytochrome c oxidase subunit 6A2, mitochondrial

NameCytochrome c oxidase subunit 6A2, mitochondrial
Synonyms
  • COX VIa-M
  • COX6A
  • COX6AH
  • COXVIAH
  • Cytochrome c oxidase polypeptide VIa-heart
  • Cytochrome c oxidase subunit VIA-muscle
Gene NameCOX6A2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0017290|Cytochrome c oxidase subunit 6A2, mitochondrial
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFR
PYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
Number of residues97
Molecular Weight10815.32
Theoretical pI11.37
GO Classification
Functions
  • cytochrome-c oxidase activity
Processes
  • generation of precursor metabolites and energy
Components
  • mitochondrial respiratory chain complex IV
General FunctionCytochrome-c oxidase activity
Specific FunctionThis protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID180946
UniProtKB IDQ02221
UniProtKB Entry NameCX6A2_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0017291|Cytochrome c oxidase subunit 6A2, mitochondrial (COX6A2)
ATGGCTTTGCCTCTGAGGCCCCTGACCCGGGGCTTGGCCAGCGCTGCCAAAGGAGGCCAC
GGAGGAGCAGGAGCTCGTACCTGGCGTCTGCTGACCTTCGTGCTGGCGCTGCCCAGCGTG
GCCCTCTGCACCTTCAACTCCTATCTCCACTCGGGCCACCGCCCGCGCCCCGAGTTCCGT
CCCTACCAACACCTCCGCATCCGCACCAAGCCCTACCCCTGGGGGGACGGCAACCACACT
CTGTTCCACAATAGCCACGTGAACCCTCTGCCCACGGGCTACGAACACCCCTGA
GenBank Gene IDM83308
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2279
Chromosome Location16
Locus16p
References
  1. Fabrizi GM, Sadlock J, Hirano M, Mita S, Koga Y, Rizzuto R, Zeviani M, Schon EA: Differential expression of genes specifying two isoforms of subunit VIa of human cytochrome c oxidase. Gene. 1992 Oct 1;119(2):307-12. 1327966
  2. Bachman NJ, Riggs PK, Siddiqui N, Makris GJ, Womack JE, Lomax MI: Structure of the human gene (COX6A2) for the heart/muscle isoform of cytochrome c oxidase subunit VIa and its chromosomal location in humans, mice, and cattle. Genomics. 1997 May 15;42(1):146-51. 9177785
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334