You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameUrokinase plasminogen activator surface receptor
Synonyms
  • MO3
  • Monocyte activation antigen Mo3
  • U-PAR
  • UPAR
Gene NamePLAUR
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001430|Urokinase plasminogen activator surface receptor
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
Number of residues335
Molecular Weight36977.62
Theoretical pI6.64
GO Classification
Functions
  • receptor activity
  • receptor binding
  • protein domain specific binding
  • enzyme binding
  • urokinase plasminogen activator receptor activity
Processes
  • cellular protein metabolic process
  • attachment of GPI anchor to protein
  • C-terminal protein lipidation
  • negative regulation of apoptotic process
  • urokinase plasminogen activator signaling pathway
  • post-translational protein modification
  • fibrinolysis
  • signal transduction
  • movement of cell or subcellular component
  • blood coagulation
  • negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway
  • negative regulation of intrinsic apoptotic signaling pathway
  • positive regulation of DNA binding
  • chemotaxis
  • positive regulation of epidermal growth factor receptor signaling pathway
  • positive regulation of release of cytochrome c from mitochondria
  • positive regulation of protein phosphorylation
  • regulation of proteolysis
Components
  • focal adhesion
  • plasma membrane
  • endoplasmic reticulum membrane
  • integral component of membrane
  • anchored component of membrane
  • extracellular exosome
  • extrinsic component of membrane
  • invadopodium membrane
  • integral component of plasma membrane
  • endoplasmic reticulum lumen
General FunctionUrokinase plasminogen activator receptor activity
Specific FunctionActs as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID37605
UniProtKB IDQ03405
UniProtKB Entry NameUPAR_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0016188|Urokinase plasminogen activator surface receptor (PLAUR)
ATGGGTCACCCGCCGCTGCTGCCGCTGCTGCTGCTGCTCCACACCTGCGTCCCAGCCTCT
TGGGGCCTGCGGTGCATGCAGTGTAAGACCAACGGGGATTGCCGTGTGGAAGAGTGCGCC
CTGGGACAGGACCTCTGCAGGACCACGATCGTGCGCTTGTGGGAAGAAGGAGAAGAGCTG
GAGCTGGTGGAGAAAAGCTGTACCCACTCAGAGAAGACCAACAGGACCCTGAGCTATCGG
ACTGGCTTGAAGATCACCAGCCTTACCGAGGTTGTGTGTGGGTTAGACTTGTGCAACCAG
GGCAACTCTGGCCGGGCTGTCACCTATTCCCGAAGCCGTTACCTCGAATGCATTTCCTGT
GGCTCATCAGACATGAGCTGTGAGAGGGGCCGGCACCAGAGCCTGCAGTGCCGCAGCCCT
GAAGAACAGTGCCTGGATGTGGTGACCCACTGGATCCAGGAAGGTGAAGAAGGGCGTCCA
AAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGT
TTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAG
GGCCCAATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAG
GGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCC
ATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACGCTCACTCTGGGGAAGCTGGTTG
CCATGTAAAAGTACTACTGCCCTGAGACCACCATGCTGTGAGGAAGCCCAAGCTACTCAT
GTATAA
GenBank Gene IDX51675
GeneCard IDNot Available
GenAtlas IDPLAUR
HGNC IDHGNC:9053
Chromosome Location19
Locus19q13
References
  1. Roldan AL, Cubellis MV, Masucci MT, Behrendt N, Lund LR, Dano K, Appella E, Blasi F: Cloning and expression of the receptor for human urokinase plasminogen activator, a central molecule in cell surface, plasmin dependent proteolysis. EMBO J. 1990 Feb;9(2):467-74. 1689240
  2. Min HY, Semnani R, Mizukami IF, Watt K, Todd RF 3rd, Liu DY: cDNA for Mo3, a monocyte activation antigen, encodes the human receptor for urokinase plasminogen activator. J Immunol. 1992 Jun 1;148(11):3636-42. 1316922
  3. Bayraktutan U, Jones P: A novel urokinase receptor on monocyte-like macrophage cell line. Biochem Soc Trans. 1993 Nov;21(4):395S. 8131971
  4. Pyke C, Eriksen J, Solberg H, Nielsen BS, Kristensen P, Lund LR, Dano K: An alternatively spliced variant of mRNA for the human receptor for urokinase plasminogen activator. FEBS Lett. 1993 Jul 12;326(1-3):69-74. 8392005
  5. Casey JR, Petranka JG, Kottra J, Fleenor DE, Rosse WF: The structure of the urokinase-type plasminogen activator receptor gene. Blood. 1994 Aug 15;84(4):1151-6. 8049431
  6. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  7. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  9. Zhu FX, Jia SD, Gao LL, He FC: [cDNA cloning and sequencing of human urokinase receptor]. Sheng Wu Gong Cheng Xue Bao. 2000 Jul;16(4):461-3. 11051819
  10. Soravia E, Grebe A, De Luca P, Helin K, Suh TT, Degen JL, Blasi F: A conserved TATA-less proximal promoter drives basal transcription from the urokinase-type plasminogen activator receptor gene. Blood. 1995 Jul 15;86(2):624-35. 7605992
  11. Behrendt N, Ronne E, Ploug M, Petri T, Lober D, Nielsen LS, Schleuning WD, Blasi F, Appella E, Dano K: The human receptor for urokinase plasminogen activator. NH2-terminal amino acid sequence and glycosylation variants. J Biol Chem. 1990 Apr 15;265(11):6453-60. 2156852
  12. Hoyer-Hansen G, Ploug M, Behrendt N, Ronne E, Dano K: Cell-surface acceleration of urokinase-catalyzed receptor cleavage. Eur J Biochem. 1997 Jan 15;243(1-2):21-6. 9030717
  13. Duke-Cohan JS, Morimoto C, Rocker JA, Schlossman SF: A novel form of dipeptidylpeptidase IV found in human serum. Isolation, characterization, and comparison with T lymphocyte membrane dipeptidylpeptidase IV (CD26). J Biol Chem. 1995 Jun 9;270(23):14107-14. 7539799
  14. Ploug M, Kjalke M, Ronne E, Weidle U, Hoyer-Hansen G, Dano K: Localization of the disulfide bonds in the NH2-terminal domain of the cellular receptor for human urokinase-type plasminogen activator. A domain structure belonging to a novel superfamily of glycolipid-anchored membrane proteins. J Biol Chem. 1993 Aug 15;268(23):17539-46. 8394346
  15. Behrendt N, Jensen ON, Engelholm LH, Mortz E, Mann M, Dano K: A urokinase receptor-associated protein with specific collagen binding properties. J Biol Chem. 2000 Jan 21;275(3):1993-2002. 10636902
  16. Artym VV, Kindzelskii AL, Chen WT, Petty HR: Molecular proximity of seprase and the urokinase-type plasminogen activator receptor on malignant melanoma cell membranes: dependence on beta1 integrins and the cytoskeleton. Carcinogenesis. 2002 Oct;23(10):1593-601. 12376466
  17. Elortza F, Nuhse TS, Foster LJ, Stensballe A, Peck SC, Jensen ON: Proteomic analysis of glycosylphosphatidylinositol-anchored membrane proteins. Mol Cell Proteomics. 2003 Dec;2(12):1261-70. Epub 2003 Sep 29. 14517339
  18. Zhu Y, Bujo H, Yamazaki H, Ohwaki K, Jiang M, Hirayama S, Kanaki T, Shibasaki M, Takahashi K, Schneider WJ, Saito Y: LR11, an LDL receptor gene family member, is a novel regulator of smooth muscle cell migration. Circ Res. 2004 Apr 2;94(6):752-8. Epub 2004 Feb 5. 14764453
  19. Elortza F, Mohammed S, Bunkenborg J, Foster LJ, Nuhse TS, Brodbeck U, Peck SC, Jensen ON: Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment. J Proteome Res. 2006 Apr;5(4):935-43. 16602701
  20. Royer-Zemmour B, Ponsole-Lenfant M, Gara H, Roll P, Leveque C, Massacrier A, Ferracci G, Cillario J, Robaglia-Schlupp A, Vincentelli R, Cau P, Szepetowski P: Epileptic and developmental disorders of the speech cortex: ligand/receptor interaction of wild-type and mutant SRPX2 with the plasminogen activator receptor uPAR. Hum Mol Genet. 2008 Dec 1;17(23):3617-30. doi: 10.1093/hmg/ddn256. Epub 2008 Aug 21. 18718938
  21. Llinas P, Le Du MH, Gardsvoll H, Dano K, Ploug M, Gilquin B, Stura EA, Menez A: Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide. EMBO J. 2005 May 4;24(9):1655-63. Epub 2005 Apr 7. 15861141
  22. Huai Q, Mazar AP, Kuo A, Parry GC, Shaw DE, Callahan J, Li Y, Yuan C, Bian C, Chen L, Furie B, Furie BC, Cines DB, Huang M: Structure of human urokinase plasminogen activator in complex with its receptor. Science. 2006 Feb 3;311(5761):656-9. 16456079
  23. Xu X, Gardsvoll H, Yuan C, Lin L, Ploug M, Huang M: Crystal structure of the urokinase receptor in a ligand-free form. J Mol Biol. 2012 Mar 9;416(5):629-41. doi: 10.1016/j.jmb.2011.12.058. Epub 2012 Jan 21. 22285761