| Name | Glutamate mutase sigma subunit |
|---|
| Synonyms | - 5.4.99.1
- Glutamate mutase S chain
- Glutamate mutase small subunit
- Methylaspartate mutase
- mutS
|
|---|
| Gene Name | glmS |
|---|
| Organism | Clostridium tetanomorphum |
|---|
| Amino acid sequence | >lcl|BSEQ0016555|Glutamate mutase sigma subunit
MEKKTIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLICV
SSLYGQGEIDCKGLREKCDEAGLKGIKLFVGGNIVVGKQNWPDVEQRFKAMGFDRVYPPG
TSPETTIADMKEVLGVE |
|---|
| Number of residues | 137 |
|---|
| Molecular Weight | 14747.8 |
|---|
| Theoretical pI | 4.74 |
|---|
| GO Classification | Functions - cobalamin binding
- metal ion binding
- methylaspartate mutase activity
Processes - anaerobic glutamate catabolic process
- glutamate catabolic process via L-citramalate
|
|---|
| General Function | Methylaspartate mutase activity |
|---|
| Specific Function | Catalyzes the carbon skeleton rearrangement of L-glutamate to L-threo-3-methylaspartate ((2S,3S)-3-methylaspartate). |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | 49240 |
|---|
| UniProtKB ID | Q05488 |
|---|
| UniProtKB Entry Name | GMSS_CLOTT |
|---|
| Cellular Location | Not Available |
|---|
| Gene sequence | >lcl|BSEQ0003511|414 bp
ATGGAGAAAAAGACTATTGTTCTTGGAGTTATTGGTTCAGACTGTCATGCAGTTGGTAAC
AAAATATTAGACCACTCATTTACAAATGCAGGCTTCAATGTTGTTAACATAGGAGTTTTA
TCATCACAGGAAGATTTTATAAATGCAGCTATAGAAACTAAAGCAGACCTTATATGTGTT
TCTTCATTATATGGACAGGGAGAAATTGACTGTAAAGGATTAAGAGAAAAGTGTGATGAA
GCAGGACTTAAAGGAATAAAATTATTTGTTGGCGGAAACATTGTTGTTGGTAAACAAAAC
TGGCCAGATGTTGAACAGAGATTTAAAGCAATGGGATTTGATAGAGTATATCCACCAGGA
ACATCTCCAGAAACAACAATAGCTGATATGAAAGAAGTTTTAGGAGTAGAATAA |
|---|
| GenBank Gene ID | X70499 |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | Not Available |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - Marsh EN, Holloway DE: Cloning and sequencing of glutamate mutase component S from Clostridium tetanomorphum. Homologies with other cobalamin-dependent enzymes. FEBS Lett. 1992 Sep 28;310(2):167-70. 1397267
- Brecht M, Kellermann J, Pluckthun A: Cloning and sequencing of glutamate mutase component E from Clostridium tetanomorphum. FEBS Lett. 1993 Mar 15;319(1-2):84-9. 8454064
- Holloway DE, Marsh EN: Adenosylcobalamin-dependent glutamate mutase from Clostridium tetanomorphum. Overexpression in Escherichia coli, purification, and characterization of the recombinant enzyme. J Biol Chem. 1994 Aug 12;269(32):20425-30. 8051138
- Tollinger M, Konrat R, Hilbert BH, Marsh EN, Krautler B: How a protein prepares for B12 binding: structure and dynamics of the B12-binding subunit of glutamate mutase from Clostridium tetanomorphum. Structure. 1998 Aug 15;6(8):1021-33. 9739092
- Hoffmann B, Tollinger M, Konrat R, Huhta M, Marsh EN, Krautler B: A protein pre-organized to trap the nucleotide moiety of coenzyme B(12): refined solution structure of the B(12)-binding subunit of glutamate mutase from Clostridium tetanomorphum. Chembiochem. 2001 Sep 3;2(9):643-55. 11828501
- Tollinger M, Eichmuller C, Konrat R, Huhta MS, Marsh EN, Krautler B: The B(12)-binding subunit of glutamate mutase from Clostridium tetanomorphum traps the nucleotide moiety of coenzyme B(12). J Mol Biol. 2001 Jun 8;309(3):777-91. 11397096
|
|---|
