You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameEarly activation antigen CD69
Synonyms
  • Activation inducer molecule
  • AIM
  • BL-AC/P26
  • C-type lectin domain family 2 member C
  • CLEC2C
  • EA1
  • Early T-cell activation antigen p60
  • GP32/28
  • Leukocyte surface antigen Leu-23
  • MLR-3
Gene NameCD69
OrganismHuman
Amino acid sequence
>lcl|BSEQ0020863|Early activation antigen CD69
MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIA
LSVGQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATL
AVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTE
VSSMECEKNLYWICNKPYK
Number of residues199
Molecular Weight22559.25
Theoretical pINot Available
GO Classification
Functions
  • transmembrane signaling receptor activity
  • calcium ion binding
  • carbohydrate binding
Processes
  • signal transduction
  • cellular response to drug
Components
  • external side of plasma membrane
  • integral component of plasma membrane
General FunctionTransmembrane signaling receptor activity
Specific FunctionInvolved in lymphocyte proliferation and functions as a signal transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets.
Pfam Domain Function
Transmembrane Regions41-61
GenBank Protein IDNot Available
UniProtKB IDQ07108
UniProtKB Entry NameCD69_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0020864|Early activation antigen CD69 (CD69)
ATGAGCTCTGAAAATTGTTTCGTAGCAGAGAACAGCTCTTTGCATCCGGAGAGTGGACAA
GAAAATGATGCCACCAGTCCCCATTTCTCAACACGTCATGAAGGGTCCTTCCAAGTTCCT
GTCCTGTGTGCTGTAATGAATGTGGTCTTCATCACCATTTTAATCATAGCTCTCATTGCC
TTATCAGTGGGCCAATACAATTGTCCAGGCCAATACACATTCTCAATGCCATCAGACAGC
CATGTTTCTTCATGCTCTGAGGACTGGGTTGGCTACCAGAGGAAATGCTACTTTATTTCT
ACTGTGAAGAGGAGCTGGACTTCAGCCCAAAATGCTTGTTCTGAACATGGTGCTACTCTT
GCTGTCATTGATTCTGAAAAGGACATGAACTTTCTAAAACGATACGCAGGTAGAGAGGAA
CACTGGGTTGGACTGAAAAAGGAACCTGGTCACCCATGGAAGTGGTCAAATGGCAAAGAA
TTTAACAACTGGTTCAACGTTACAGGGTCTGACAAGTGTGTTTTTCTGAAAAACACAGAG
GTCAGCAGCATGGAATGTGAGAAGAATTTATACTGGATATGTAACAAACCTTACAAATAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:1694
Chromosome Location12
LocusNot Available
References
  1. Hamann J, Fiebig H, Strauss M: Expression cloning of the early activation antigen CD69, a type II integral membrane protein with a C-type lectin domain. J Immunol. 1993 Jun 1;150(11):4920-7. 8496594
  2. Lopez-Cabrera M, Santis AG, Fernandez-Ruiz E, Blacher R, Esch F, Sanchez-Mateos P, Sanchez-Madrid F: Molecular cloning, expression, and chromosomal localization of the human earliest lymphocyte activation antigen AIM/CD69, a new member of the C-type animal lectin superfamily of signal-transmitting receptors. J Exp Med. 1993 Aug 1;178(2):537-47. 8340758
  3. Ziegler SF, Ramsdell F, Hjerrild KA, Armitage RJ, Grabstein KH, Hennen KB, Farrah T, Fanslow WC, Shevach EM, Alderson MR: Molecular characterization of the early activation antigen CD69: a type II membrane glycoprotein related to a family of natural killer cell activation antigens. Eur J Immunol. 1993 Jul;23(7):1643-8. 8100776
  4. Santis AG, Lopez-Cabrera M, Hamann J, Strauss M, Sanchez-Madrid F: Structure of the gene coding for the human early lymphocyte activation antigen CD69: a C-type lectin receptor evolutionarily related with the gene families of natural killer cell-specific receptors. Eur J Immunol. 1994 Jul;24(7):1692-7. 8026529
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Natarajan K, Sawicki MW, Margulies DH, Mariuzza RA: Crystal structure of human CD69: a C-type lectin-like activation marker of hematopoietic cells. Biochemistry. 2000 Dec 5;39(48):14779-86. 11101293
  7. Llera AS, Viedma F, Sanchez-Madrid F, Tormo J: Crystal structure of the C-type lectin-like domain from the human hematopoietic cell receptor CD69. J Biol Chem. 2001 Mar 9;276(10):7312-9. Epub 2000 Oct 17. 11036086
  8. Vanek O, Nalezkova M, Kavan D, Borovickova I, Pompach P, Novak P, Kumar V, Vannucci L, Hudecek J, Hofbauerova K, Kopecky V Jr, Brynda J, Kolenko P, Dohnalek J, Kaderavek P, Chmelik J, Gorcik L, Zidek L, Sklenar V, Bezouska K: Soluble recombinant CD69 receptors optimized to have an exceptional physical and chemical stability display prolonged circulation and remain intact in the blood of mice. FEBS J. 2008 Nov;275(22):5589-606. doi: 10.1111/j.1742-4658.2008.06683.x. 18959746