You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSolute carrier family 13 member 2
Synonyms
  • Na(+)/dicarboxylate cotransporter 1
  • NaDC-1
  • NADC1
  • Renal sodium/dicarboxylate cotransporter
  • SDCT1
Gene NameSLC13A2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0000891|Solute carrier family 13 member 2
MATCWQALWAYRSYLIVFFVPILLLPLPILVPSKEAYCAYAIILMALFWCTEALPLAVTA
LFPLILFPMMGIVDASEVAVEYLKDSNLLFFGGLLVAIAVEHWNLHKRIALRVLLIVGVR
PAPLILGFMLVTAFLSMWISNTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQ
EPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGT
APNLVLQGQINSLFPQNGNVVNFASWFSFAFPTMVILLLLAWLWLQILFLGFNFRKNFGI
GEKMQEQQQAAYCVIQTEHRLLGPMTFAEKAISILFVILVLLWFTREPGFFLGWGNLAFP
NAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWN
IVLLLGGGYALAKGSERSGLSEWLGNKLTPLQSVPAPAIAIILSLLVATFTECTSNVATT
TIFLPILASMAQAICLHPLYVMLPCTLATSLAFMLPVATPPNAIVFSFGDLKVLDMARAG
FLLNIIGVLIIALAINSWGIPLFSLHSFPSWAQSNTTAQCLPSLANTTTPSP
Number of residues592
Molecular Weight64409.495
Theoretical pI7.01
GO Classification
Functions
  • low-affinity sodium
Processes
  • dicarboxylic acid transport
  • anion transmembrane transport
  • transmembrane transport
  • transport
Components
  • membrane
  • plasma membrane
  • extracellular exosome
  • integral component of plasma membrane
General FunctionLow-affinity sodium:dicarboxylate symporter activity
Specific FunctionCotransport of sodium ions and dicarboxylates such as succinate and citrate.
Pfam Domain Function
Transmembrane Regions13-33 53-73 86-106 114-134 221-241 274-294 324-344 371-391 450-470 482-502 511-531 545-565
GenBank Protein ID1098557
UniProtKB IDQ13183
UniProtKB Entry NameS13A2_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0016096|Solute carrier family 13 member 2 (SLC13A2)
ATGGCCACCTGCTGGCAGGCCCTGTGGGCCTATCGCTCCTACCTGATCGTGTTCTTCGTG
CCCATTCTCCTGCTGCCTCTGCCCATCCTCGTCCCCAGTAAGGAGGCCTACTGCGCGTAT
GCCATCATCCTCATGGCGCTCTTCTGGTGCACTGAGGCCCTGCCCCTGGCCGTCACTGCC
CTCTTCCCCTTAATCCTGTTCCCTATGATGGGCATCGTGGATGCCTCTGAGATCATTCAG
AGACCATTTCCATCCAGTTTCGAGAGCCCAGGGGAATGCCAGTCTGTGGGAATGTCAGTG
ACTGCATCCCATAACCTCGGGGGCACCGTGGGAGACTCCAGGGTCTTCCCGCCGCTCAGC
CATGTCTCCACCTGCCAGGTTGCCGTCGAGTATCTTAAGGACTCCAACCTCCTGTTCTTC
GGGGGGCTGCTGGTGGCCATCGCGGTGGAACACTGGAACCTGCATAAACGCATCGCCCTC
CGTGTCCTCCTCATCGTTGGGGTGCGGCCTGCCCCGCTAATCCTGGGCTTCATGCTGGTC
ACGGCCTTCCTGTCCATGTGGATCAGCAACACGGCCACCTCAGCCATGATGGTGCCCATC
GCACATGCCGTCCTGGACCAGCTGCACAGCTCGCAAGCCAGCAGCAACGTCGAGGAGGGC
AGCAACAACCCCACCTTCGAGCTCCAGGAACCAAGTCCCCAGAAGGAGGTGACCAAGCTT
GATAATGGGCAGGCCCTCCCTGTCACGTCTGCCTCTTCGGAGGGGAGGGCACATCTCAGC
CAGAAGCATCTCCACCTCACCCAGTGCATGAGCCTGTGCGTGTGCTACTCCGCCAGCATC
GGGGGCATCGCCACGCTGACTGGCACCGCACCCAACCTGGTGCTGCAAGGCCAGATCAAC
TCGCTCTTCCCCCAAAACGGCAACGTGGTGAACTTCGCCTCCTGGTTCAGCTTCGCCTTC
CCCACCATGGTCATCTTGCTGCTGCTGGCCTGGTTGTGGCTGCAGATCCTCTTCCTGGGC
TTCAACTTCCGGAAGAACTTTGGCATTGGGGAAAAGATGCAGGAGCAACAGCAGGCAGCC
TACTGCGTCATCCAGACCGAGCACAGGCTGCTGGGCCCCATGACCTTTGCAGAAAAGGCC
ATCAGCATCCTATTCGTCATCCTGGTGCTGCTCTGGTTCACCCGGGAGCCGGGCTTTTTT
CTTGGCTGGGGCAATTTGGCTTTTCCCAATGCCAAGGGGGAGAGCATGGTGTCCGATGGG
ACAGTGGCCATCTTCATCGGCATAATTATGTTCATCATACCCTCCAAGTTCCCAGGGCTG
ACCCAGGACCCAGAAAACCCAGGGAAGCTGAAGGCCCCTCTTGGCCTCCTCGACTGGAAG
ACGGTGAACCAGAAGATGCCGTGGAATATCGTGTTATTGCTGGGTGGTGGCTATGCCCTG
GCCAAGGGCAGTGAGCGATCGGGCCTGTCAGAGTGGCTGGGAAACAAGCTGACCCCACTG
CAGAGTGTGCCAGCTCCAGCCATTGCCATCATCCTCTCCCTCCTGGTGGCCACCTTCACC
GAGTGCACTAGCAACGTGGCCACCACTACGATCTTCCTGCCCATCCTAGCCTCCATGGCC
CAGGCCATCTGCCTCCACCCTCTCTACGTCATGCTCCCCTGCACTCTGGCCACCTCCCTG
GCCTTCATGTTGCCTGTGGCCACCCCGCCCAATGCCATCGTCTTCTCTTTCGGGGACCTC
AAAGTGTTGGATATGGCCCGGGCAGGATTCCTCCTCAACATCATTGGAGTCCTGATCATC
GCACTGGCCATCAACAGCTGGGGCATCCCCCTCTTCAGCCTGCACTCTTTCCCCTCCTGG
GCACAGTCCAACACCACAGCCCAGTGCCTGCCAAGCCTGGCCAACACCACCACACCAAGC
CCCTAG
GenBank Gene IDU26209
GeneCard IDNot Available
GenAtlas IDSLC13A2
HGNC IDHGNC:10917
Chromosome Location17
Locus17p13.2
References
  1. Pajor AM: Molecular cloning and functional expression of a sodium-dicarboxylate cotransporter from human kidney. Am J Physiol. 1996 Apr;270(4 Pt 2):F642-8. 8967342
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Okamoto N, Aruga S, Matsuzaki S, Takahashi S, Matsushita K, Kitamura T: Associations between renal sodium-citrate cotransporter (hNaDC-1) gene polymorphism and urinary citrate excretion in recurrent renal calcium stone formers and normal controls. Int J Urol. 2007 Apr;14(4):344-9. 17470169