You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameC-Jun-amino-terminal kinase-interacting protein 2
Synonyms
  • IB-2
  • IB2
  • Islet-brain-2
  • JIP-2
  • JIP2
  • JNK MAP kinase scaffold protein 2
  • Mitogen-activated protein kinase 8-interacting protein 2
  • PRKM8IPL
Gene NameMAPK8IP2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008804|C-Jun-amino-terminal kinase-interacting protein 2
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPA
PGPLIPSPSVEEPHKHRPTTLRLTTLGAQDSLNNNGGFDLVRPASWQETALCSPAPEALR
ELPGPLPATDTGPGGAQSPVRPGCDCEGNRPAEPPAPGGTSPSSDPGIEADLRSRSSGGR
GGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSSGRSSHLTNSIEEA
SSPASEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNLVSRMIS
EGSSPIRCPGQCLSPAPRPPGEPVSPAGGAAQDSQDPEAAAGPGGVELVDMETLCAPPPP
APAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRACSAACSEEEDEEDDEEEE
DAEDSAGSPGGRGTGPSAPRDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGHDSEEDS
GGEASEEEAGAALLGGGQVSGDTSPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLV
NGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYA
HAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLR
PPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLS
RFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE
Number of residues824
Molecular Weight87973.915
Theoretical pINot Available
GO Classification
Functions
  • structural molecule activity
  • protein kinase activator activity
  • protein kinase binding
  • kinesin binding
  • MAP-kinase scaffold activity
  • beta-amyloid binding
Processes
  • mating behavior
  • positive regulation of stress-activated MAPK cascade
  • regulation of N-methyl-D-aspartate selective glutamate receptor activity
  • MAPK cascade
  • regulation of JNK cascade
  • dendrite morphogenesis
  • activation of protein kinase activity
  • social behavior
  • nonassociative learning
  • regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity
  • regulation of receptor activity
  • JNK cascade
  • signal complex assembly
  • excitatory postsynaptic potential
  • regulation of synaptic transmission, glutamatergic
  • behavioral fear response
Components
  • protein complex
  • neuronal postsynaptic density
  • neuronal cell body
  • intracellular
  • cytoplasm
General FunctionStructural molecule activity
Specific FunctionThe JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. JIP2 inhibits IL1 beta-induced apoptosis in insulin-secreting cells. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ13387
UniProtKB Entry NameJIP2_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013424|C-Jun-amino-terminal kinase-interacting protein 2 (MAPK8IP2)
ATGGCGGATCGCGCGGAGATGTTTTCTCTCTCCACCTTCCACTCGCTGTCGCCGCCGGGC
TGCAGGCCTCCCCAGGACATAAGCCTGGAAGAATTTGACGACGAAGATCTGTCTGAGATC
ACTGATGACTGTGGCCTGGGCCTCAGCTACGACTCAGACCACTGTGAGAAGGACAGCCTC
TCCCTGGGGCGCTCGGAGCAGCCGCACCCCATCTGCTCCTTCCAGGATGACTTCCAGGAG
TTTGAGATGATCGATGACAATGAAGAGGAGGACGATGAGGACGAGGAAGAGGAGGAGGAG
GAGGAGGAGGGAGATGGGGAAGGCCAGGAGGGAGGAGACCCTGGCTCAGAGGCACCTGCC
CCCGGGCCCCTTATCCCCTCCCCTTCCGTGGAGGAGCCCCACAAGCACCGGCCCACCACC
CTCCGTCTGACCACACTGGGGGCCCAGGACTCCCTAAACAACAACGGAGGCTTTGACCTG
GTGCGTCCGGCCTCCTGGCAGGAGACAGCGCTATGCTCACCCGCCCCGGAGGCCCTCAGA
GAGCTCCCGGGCCCCCTCCCTGCCACGGACACCGGGCCCGGCGGGGCGCAGTCGCCAGTG
CGCCCGGGTTGCGACTGCGAAGGGAACCGGCCTGCGGAACCCCCTGCGCCAGGGGGGACT
TCGCCCTCCTCAGATCCCGGCATCGAGGCTGACCTGAGAAGCCGCTCGAGCGGCGGCCGC
GGGGGACGTCGCAGCAGCCAGGAGCTGTCCTCGCCCGGCTCCGACTCGGAGGACGCGGGC
GGCGCGCGCCTGGGGCGCATGATCTCGTCCATCTCGGAGACGGAGCTGGAGCTGAGCAGC
GATGGCGGAAGCAGCAGCAGCGGCCGCTCCTCGCACCTCACCAACTCCATCGAGGAGGCC
TCGTCGCCCGCCTCGGAGCCGGAGCCCCCGCGCGAACCCCCGCGCCGCCCCGCCTTCCTG
CCCGTGGGCCCCGACGACACCAACAGCGAGTACGAGTCGGGGTCGGAGTCGGAGCCGGAC
CTCAGCGAGGACGCGGACTCGCCCTGGCTGCTCAGCAACCTGGTGAGCCGCATGATCTCC
GAGGGCTCCTCGCCCATCCGCTGCCCCGGCCAGTGCCTGTCTCCTGCGCCGCGCCCGCCC
GGGGAGCCCGTGTCGCCGGCCGGCGGGGCCGCCCAGGACTCCCAGGACCCCGAGGCGGCC
GCGGGGCCCGGCGGCGTGGAGCTGGTGGACATGGAGACGCTGTGCGCGCCGCCGCCGCCC
GCGCCCGCCGCGCCTCGACCCGGCCCCGCGCAGCCCGGGCCCTGCCTATTCCTCAGCAAC
CCCACGCGTGACACCATCACGCCGCTGTGGGCCGCGCCCGGCCGCGCCGCCCGCCCGGGA
CGAGCCTGCTCCGCCGCCTGCTCCGAGGAGGAGGACGAAGAGGACGACGAGGAAGAGGAG
GATGCCGAGGACAGTGCGGGGTCCCCCGGGGGCAGGGGCACGGGCCCCTCGGCGCCGCGG
GACGCGTCGCTGGTGTACGACGCGGTCAAGTACACGCTGGTGGTGGATGAGCACACGCAG
CTGGAGCTGGTGAGCCTGCGGCGCTGTGCTGGGCTGGGCCACGACAGCGAAGAGGACAGC
GGCGGGGAGGCCAGCGAGGAGGAGGCGGGCGCGGCGCTGCTAGGCGGCGGTCAGGTCTCG
GGGGACACCTCGCCGGACAGCCCTGACCTCACTTTCTCCAAGAAGTTCCTCAATGTCTTC
GTCAACAGCACATCTCGGTCCTCCAGCACCGAGTCCTTTGGCCTTTTCTCCTGTCTGGTC
AACGGCGAGGAGCGAGAGCAGACTCACCGGGCTGTGTTCAGGTTCATCCCGCGGCATCCA
GACGAGCTGGAGCTGGATGTGGATGACCCTGTGTTGGTGGAGGCCGAGGAGGACGACTTC
TGGTTCCGTGGCTTCAACATGCGCACGGGGGAGCGCGGTGTGTTTCCTGCCTTCTACGCC
CATGCGGTGCCCGGCCCTGCCAAGGACCTGCTGGGGAGTAAGCGGAGCCCCTGCTGGGTG
GAGCGCTTTGACGTGCAGTTCCTGGGCTCCGTGGAGGTGCCCTGCCACCAGGGCAACGGC
ATCCTGTGTGCAGCCATGCAGAAGATTGCCACTGCCCGGAAACTGACCGTCCACCTGCGC
CCTCCTGCCTCCTGTGACCTCGAGATCTCTCTTCGGGGGGTCAAGCTGAGTCTGAGCGGA
GGAGGGCCCGAGTTCCAGCGCTGCAGCCATTTCTTCCAGATGAAGAACATCTCCTTCTGC
GGCTGCCATCCCCGCAACAGCTGCTATTTCGGCTTCATCACCAAACACCCCCTGCTGAGC
CGCTTCGCCTGCCACGTCTTTGTCTCCCAGGAGTCCATGAGGCCGGTGGCGCAGAGTGTG
GGCCGCGCCTTCCTGGAGTACTACCAAGAGCACCTGGCGTACGCCTGCCCCACGGAGGAC
ATCTACCTGGAGTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6883
Chromosome Location22
LocusNot Available
References
  1. Yasuda J, Whitmarsh AJ, Cavanagh J, Sharma M, Davis RJ: The JIP group of mitogen-activated protein kinase scaffold proteins. Mol Cell Biol. 1999 Oct;19(10):7245-54. 10490659
  2. Negri S, Oberson A, Steinmann M, Sauser C, Nicod P, Waeber G, Schorderet DF, Bonny C: cDNA cloning and mapping of a novel islet-brain/JNK-interacting protein. Genomics. 2000 Mar 15;64(3):324-30. 10756100
  3. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. 10591208
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Collins JE, Goward ME, Cole CG, Smink LJ, Huckle EJ, Knowles S, Bye JM, Beare DM, Dunham I: Reevaluating human gene annotation: a second-generation analysis of chromosome 22. Genome Res. 2003 Jan;13(1):27-36. 12529303
  6. Yu W, Andersson B, Worley KC, Muzny DM, Ding Y, Liu W, Ricafrente JY, Wentland MA, Lennon G, Gibbs RA: Large-scale concatenation cDNA sequencing. Genome Res. 1997 Apr;7(4):353-8. 9110174
  7. Schoorlemmer J, Goldfarb M: Fibroblast growth factor homologous factors are intracellular signaling proteins. Curr Biol. 2001 May 15;11(10):793-7. 11378392