You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMetabotropic glutamate receptor 3
Synonyms
  • GPRC1C
  • MGLUR3
Gene NameGRM3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004599|Metabotropic glutamate receptor 3
MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
Number of residues879
Molecular Weight98878.05
Theoretical pI7.7
GO Classification
Functions
  • G-protein coupled receptor activity
  • glutamate receptor activity
  • calcium channel regulator activity
  • group II metabotropic glutamate receptor activity
Processes
  • synaptic transmission
  • negative regulation of adenylate cyclase activity
  • regulation of synaptic transmission, glutamatergic
  • adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway
Components
  • postsynaptic membrane
  • plasma membrane
  • integral component of plasma membrane
  • postsynaptic density
  • presynaptic membrane
  • dendritic spine
  • axon
General FunctionGroup ii metabotropic glutamate receptor activity
Specific FunctionG-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity.
Pfam Domain Function
Transmembrane Regions577-599 614-634 646-664 689-709 735-756 770-792 803-828
GenBank Protein ID1171564
UniProtKB IDQ14832
UniProtKB Entry NameGRM3_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0011682|Metabotropic glutamate receptor 3 (GRM3)
ATGAAGATGTTGACAAGACTGCAAGTTCTTACCTTAGCTTTGTTTTCAAAGGGATTTTTA
CTCTCTTTAGGGGACCATAACTTTCTAAGGAGAGAGATTAAAATAGAAGGTGACCTTGTT
TTAGGGGGCCTGTTTCCTATTAACGAAAAAGGCACTGGAACTGAAGAATGTGGGCGAATC
AATGAAGACCGAGGGATTCAACGCCTGGAAGCCATGTTGTTTGCTATTGATGAAATCAAC
AAAGATGATTACTTGCTACCAGGAGTGAAGTTGGGTGTTCACATTTTGGATACATGTTCA
AGGGATACCTATGCATTGGAGCAATCACTGGAGTTTGTCAGGGCATCTTTGACAAAAGTG
GATGAAGCTGAGTATATGTGTCCTGATGGATCCTATGCCATTCAAGAAAACATCCCACTT
CTCATTGCAGGGGTCATTGGTGGCTCTTATAGCAGTGTTTCCATACAGGTGGCAAACCTG
CTGCGGCTCTTCCAGATCCCTCAGATCAGCTACGCATCCACCAGCGCCAAACTCAGTGAT
AAGTCGCGCTATGATTACTTTGCCAGGACCGTGCCCCCCGACTTCTACCAGGCCAAAGCC
ATGGCTGAGATCTTGCGCTTCTTCAACTGGACCTACGTGTCCACAGTAGCCTCCGAGGGT
GATTACGGGGAGACAGGGATCGAGGCCTTCGAGCAGGAAGCCCGCCTGCGCAACATCTGC
ATCGCTACGGCGGAGAAGGTGGGCCGCTCCAACATCCGCAAGTCCTACGACAGCGTGATC
CGAGAACTGTTGCAGAAGCCCAACGCGCGCGTCGTGGTCCTCTTCATGCGCAGCGACGAC
TCGCGGGAGCTCATTGCAGCCGCCAGCCGCGCCAATGCCTCCTTCACCTGGGTGGCCAGC
GACGGCTGGGGCGCGCAGGAGAGCATCATCAAGGGCAGCGAGCATGTGGCCTACGGCGCC
ATCACCCTGGAGCTGGCCTCCCAGCCTGTCCGCCAGTTCGACCGCTACTTCCAGAGCCTC
AACCCCTACAACAACCACCGCAACCCCTGGTTCCGGGACTTCTGGGAGCAAAAGTTTCAG
TGCAGCCTCCAGAACAAACGCAACCACAGGCGCGTCTGCGACAAGCACCTGGCCATCGAC
AGCAGCAACTACGAGCAAGAGTCCAAGATCATGTTTGTGGTGAACGCGGTGTATGCCATG
GCCCACGCTTTGCACAAAATGCAGCGCACCCTCTGTCCCAACACTACCAAGCTTTGTGAT
GCTATGAAGATCCTGGATGGGAAGAAGTTGTACAAGGATTACTTGCTGAAAATCAACTTC
ACGGCTCCATTCAACCCAAATAAAGATGCAGATAGCATAGTCAAGTTTGACACTTTTGGA
GATGGAATGGGGCGATACAACGTGTTCAATTTCCAAAATGTAGGTGGAAAGTATTCCTAC
TTGAAAGTTGGTCACTGGGCAGAAACCTTATCGCTAGATGTCAACTCTATCCACTGGTCC
CGGAACTCAGTCCCCACTTCCCAGTGCAGCGACCCCTGTGCCCCCAATGAAATGAAGAAT
ATGCAACCAGGGGATGTCTGCTGCTGGATTTGCATCCCCTGTGAACCCTACGAATACCTG
GCTGATGAGTTTACCTGTATGGATTGTGGGTCTGGACAGTGGCCCACTGCAGACCTAACT
GGATGCTATGACCTTCCTGAGGACTACATCAGGTGGGAAGACGCCTGGGCCATTGGCCCA
GTCACCATTGCCTGTCTGGGTTTTATGTGTACATGCATGGTTGTAACTGTTTTTATCAAG
CACAACAACACACCCTTGGTCAAAGCATCGGGCCGAGAACTCTGCTACATCTTATTGTTT
GGGGTTGGCCTGTCATACTGCATGACATTCTTCTTCATTGCCAAGCCATCACCAGTCATC
TGTGCATTGCGCCGACTCGGGCTGGGGAGTTCCTTCGCTATCTGTTACTCAGCCCTGCTG
ACCAAGACAAACTGCATTGCCCGCATCTTCGATGGGGTCAAGAATGGCGCTCAGAGGCCA
AAATTCATCAGCCCCAGTTCTCAGGTTTTCATCTGCCTGGGTCTGATCCTGGTGCAAATT
GTGATGGTGTCTGTGTGGCTCATCCTGGAGGCCCCAGGCACCAGGAGGTATACCCTTGCA
GAGAAGCGGGAAACAGTCATCCTAAAATGCAATGTCAAAGATTCCAGCATGTTGATCTCT
CTTACCTACGATGTGATCCTGGTGATCTTATGCACTGTGTACGCCTTCAAAACGCGGAAG
TGCCCAGAAAATTTCAACGAAGCTAAGTTCATAGGTTTTACCATGTACACCACGTGCATC
ATCTGGTTGGCCTTCCTCCCTATATTTTATGTGACATCAAGTGACTACAGAGTGCAGACG
ACAACCATGTGCATCTCTGTCAGCCTGAGTGGCTTTGTGGTCTTGGGCTGTTTGTTTGCA
CCCAAGGTTCACATCATCCTGTTTCAACCCCAGAAGAATGTTGTCACACACAGACTGCAC
CTCAACAGGTTCAGTGTCAGTGGAACTGGGACCACATACTCTCAGTCCTCTGCAAGCACG
TATGTGCCAACGGTGTGCAATGGGCGGGAAGTCCTCGACTCCACCACCTCATCTCTGTGA
GenBank Gene IDX77748
GeneCard IDNot Available
GenAtlas IDGRM3
HGNC IDHGNC:4595
Chromosome Location7
Locus7q21.1-q21.2
References
  1. Makoff A, Volpe F, Lelchuk R, Harrington K, Emson P: Molecular characterization and localization of human metabotropic glutamate receptor type 3. Brain Res Mol Brain Res. 1996 Aug;40(1):55-63. 8840013
  2. Sartorius LJ, Nagappan G, Lipska BK, Lu B, Sei Y, Ren-Patterson R, Li Z, Weinberger DR, Harrison PJ: Alternative splicing of human metabotropic glutamate receptor 3. J Neurochem. 2006 Feb;96(4):1139-48. Epub 2006 Jan 17. 16417579
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. 12853948
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334