You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMetabotropic glutamate receptor 4
Synonyms
  • GPRC1D
  • MGLUR4
Gene NameGRM4
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001662|Metabotropic glutamate receptor 4
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
Number of residues912
Molecular Weight101866.835
Theoretical pI8.98
GO Classification
Functions
  • group III metabotropic glutamate receptor activity
  • G-protein coupled receptor activity
  • glutamate receptor activity
Processes
  • activation of MAPK activity
  • positive regulation of MAPK cascade
  • regulation of synaptic transmission, glutamatergic
  • adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway
  • synaptic transmission
  • neurotransmitter secretion
  • learning
  • regulation of neuron apoptotic process
Components
  • presynaptic membrane
  • intracellular
  • plasma membrane
  • cytoplasmic vesicle
  • integral component of plasma membrane
General FunctionGroup iii metabotropic glutamate receptor activity
Specific FunctionG-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate cyclase activity.
Pfam Domain Function
Transmembrane Regions588-610 625-645 657-675 700-720 751-772 786-808 822-847
GenBank Protein ID1160183
UniProtKB IDQ14833
UniProtKB Entry NameGRM4_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0019017|Metabotropic glutamate receptor 4 (GRM4)
ATGCCTGGGAAGAGAGGCTTGGGCTGGTGGTGGGCCCGGCTGCCCCTTTGCCTGCTCCTC
AGCCTTTACGGCCCCTGGATGCCTTCCTCCCTGGGAAAGCCCAAAGGCCACCCTCACATG
AATTCCATCCGCATAGATGGGGACATCACACTGGGAGGCCTGTTCCCGGTGCATGGCCGG
GGCTCAGAGGGCAAGCCCTGTGGAGAACTTAAGAAGGAAAAGGGCATCCACCGGCTGGAG
GCCATGCTGTTCGCCCTGGATCGCATCAACAACGACCCGGACCTGCTGCCTAACATCACG
CTGGGCGCCCGCATTCTGGACACCTGCTCCAGGGACACCCATGCCCTCGAGCAGTCGCTG
ACCTTTGTGCAGGCGCTCATCGAGAAGGATGGCACAGAGGTCCGCTGTGGCAGTGGCGGC
CCACCCATCATCACCAAGCCTGAACGTGTGGTGGGTGTCATCGGTGCTTCAGGGAGCTCG
GTCTCCATCATGGTGGCCAACATCCTTCGCCTCTTCAAGATACCCCAGATCAGCTACGCC
TCCACAGCGCCAGACCTGAGTGACAACAGCCGCTACGACTTCTTCTCCCGCGTGGTGCCC
TCGGACACGTACCAGGCCCAGGCCATGGTGGACATCGTCCGTGCCCTCAAGTGGAACTAT
GTGTCCACAGTGGCCTCGGAGGGCAGCTATGGTGAGAGCGGTGTGGAGGCCTTCATCCAG
AAGTCCCGTGAGGACGGGGGCGTGTGCATCGCCCAGTCGGTGAAGATACCACGGGAGCCC
AAGGCAGGCGAGTTCGACAAGATCATCCGCCGCCTCCTGGAGACTTCGAACGCCAGGGCA
GTCATCATCTTTGCCAACGAGGATGACATCAGGCGTGTGCTGGAGGCAGCACGAAGGGCC
AACCAGACAGGCCATTTCTTCTGGATGGGCTCTGACAGCTGGGGCTCCAAGATTGCACCT
GTGCTGCACCTGGAGGAGGTGGCTGAGGGTGCTGTCACGATCCTCCCCAAGAGGATGTCC
GTACGAGGCTTCGACCGCTACTTCTCCAGCCGCACGCTGGACAACAACCGGCGCAACATC
TGGTTTGCCGAGTTCTGGGAGGACAACTTCCACTGCAAGCTGAGCCGCCACGCCCTCAAG
AAGGGCAGCCACGTCAAGAAGTGCACCAACCGTGAGCGAATTGGGCAGGATTCAGCTTAT
GAGCAGGAGGGGAAGGTGCAGTTTGTGATCGATGCCGTGTACGCCATGGGCCACGCGCTG
CACGCCATGCACCGTGACCTGTGTCCCGGCCGCGTGGGGCTCTGCCCGCGCATGGACCCT
GTAGATGGCACCCAGCTGCTTAAGTACATCCGAAACGTCAACTTCTCAGGCATCGCAGGG
AACCCTGTGACCTTCAATGAGAATGGAGATGCGCCTGGGCGCTATGACATCTACCAATAC
CAGCTGCGCAACGATTCTGCCGAGTACAAGGTCATTGGCTCCTGGACTGACCACCTGCAC
CTTAGAATAGAGCGGATGCACTGGCCGGGGAGCGGGCAGCAGCTGCCCCGCTCCATCTGC
AGCCTGCCCTGCCAACCGGGTGAGCGGAAGAAGACAGTGAAGGGCATGCCTTGCTGCTGG
CACTGCGAGCCTTGCACAGGGTACCAGTACCAGGTGGACCGCTACACCTGTAAGACGTGT
CCCTATGACATGCGGCCCACAGAGAACCGCACGGGCTGCCGGCCCATCCCCATCATCAAG
CTTGAGTGGGGCTCGCCCTGGGCCGTGCTGCCCCTCTTCCTGGCCGTGGTGGGCATCGCT
GCCACGTTGTTCGTGGTGATCACCTTTGTGCGCTACAACGACACGCCCATCGTCAAGGCC
TCGGGCCGTGAACTGAGCTACGTGCTGCTGGCAGGCATCTTCCTGTGCTATGCCACCACC
TTCCTCATGATCGCTGAGCCCGACCTTGGCACCTGCTCGCTGCGCCGAATCTTCCTGGGA
CTAGGGATGAGCATCAGCTATGCAGCCCTGCTCACCAAGACCAACCGCATCTACCGCATC
TTCGAGCAGGGCAAGCGCTCGGTCAGTGCCCCACGCTTCATCAGCCCCGCCTCACAGCTG
GCCATCACCTTCAGCCTCATCTCGCTGCAGCTGCTGGGCATCTGTGTGTGGTTTGTGGTG
GACCCCTCCCACTCGGTGGTGGACTTCCAGGACCAGCGGACACTCGACCCCCGCTTCGCC
AGGGGTGTGCTCAAGTGTGACATCTCGGACCTGTCGCTCATCTGCCTGCTGGGCTACAGC
ATGCTGCTCATGGTCACGTGCACCGTGTATGCCATCAAGACACGCGGCGTGCCCGAGACC
TTCAATGAGGCCAAGCCCATTGGCTTCACCATGTACACCACTTGCATCGTCTGGCTGGCC
TTCATCCCCATCTTCTTTGGCACCTCGCAGTCGGCCGACAAGCTGTACATCCAGACGACG
ACGCTGACGGTCTCGGTGAGTCTGAGCGCCTCGGTGTCCCTGGGAATGCTCTACATGCCC
AAAGTCTACATCATCCTCTTCCACCCGGAGCAGAACGTGCCCAAGCGCAAGCGCAGCCTC
AAAGCCGTCGTTACGGCGGCCACCATGTCCAACAAGTTCACGCAGAAGGGCAACTTCCGG
CCCAACGGAGAGGCCAAGTCTGAGCTCTGCGAGAACCTTGAGGCCCCAGCGCTGGCCACC
AAACAGACTTACGTCACTTACACCAACCATGCAATCTAG
GenBank Gene IDX80818
GeneCard IDNot Available
GenAtlas IDGRM4
HGNC IDHGNC:4596
Chromosome Location6
Locus6p21.3
References
  1. Makoff A, Lelchuk R, Oxer M, Harrington K, Emson P: Molecular characterization and localization of human metabotropic glutamate receptor type 4. Brain Res Mol Brain Res. 1996 Apr;37(1-2):239-48. 8738157
  2. Wu S, Wright RA, Rockey PK, Burgett SG, Arnold JS, Rosteck PR Jr, Johnson BG, Schoepp DD, Belagaje RM: Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells. Brain Res Mol Brain Res. 1998 Jan;53(1-2):88-97. 9473604
  3. Flor PJ, Lukic S, Ruegg D, Leonhardt T, Knopfel T, Kuhn R: Molecular cloning, functional expression and pharmacological characterization of the human metabotropic glutamate receptor type 4. Neuropharmacology. 1995 Feb;34(2):149-55. 7617140
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  5. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. 14574404
  6. Ohtsuki T, Toru M, Arinami T: Mutation screening of the metabotropic glutamate receptor mGluR4 (GRM4) gene in patients with schizophrenia. Psychiatr Genet. 2001 Jun;11(2):79-83. 11525421