You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameNucleolar and coiled-body phosphoprotein 1
Synonyms
  • 140 kDa nucleolar phosphoprotein
  • HCV NS5A-transactivated protein 13
  • Hepatitis C virus NS5A-transactivated protein 13
  • KIAA0035
  • Nopp140
  • NS5ATP13
  • Nucleolar 130 kDa protein
  • Nucleolar phosphoprotein p130
Gene NameNOLC1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009848|Nucleolar and coiled-body phosphoprotein 1
MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKS
AKVPERKLQANGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAA
AKASESSSSEESSDDDDEEDQKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPP
KNQKPKITPVTVKAQTKAPPKPARAAPKIANGKAASSSSSSSSSSSSDDSEEEKAAATPK
KTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKKPMKNKPGPYSSVPPPSAPPP
KKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATTKPPPAKKAAE
SSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRK
ADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEE
EEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPR
PQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQA
KKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQ
VLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE
Number of residues699
Molecular Weight73602.49
Theoretical pINot Available
GO Classification
Functions
  • poly(A) RNA binding
  • ATP binding
  • GTP binding
Processes
  • mitotic nuclear division
  • nucleolus organization
  • cell cycle
  • rRNA processing
Components
  • Cajal body
  • cytoplasm
  • nucleolus
  • nucleoplasm
General FunctionPoly(a) rna binding
Specific FunctionRelated to nucleologenesis, may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. May play an important role in transcription catalyzed by RNA polymerase I.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ14978
UniProtKB Entry NameNOLC1_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0013947|Nucleolar and coiled-body phosphoprotein 1 (NOLC1)
ATGGCGGACGCCGGCATTCGCCGCGTGGTTCCCAGCGACCTGTATCCCCTCGTGCTCGGC
TTCCTGCGCGATAACCAACTCTCAGAGGTGGCCAATAAGTTCGCCAAAGCGACAGGAGCT
ACACAGCAGGATGCCAATGCCTCTTCCCTCTTAGACATCTATAGCTTCTGGCTCAAGTCT
GCCAAGGTCCCAGAGCGAAAGTTACAGGCAAATGGACCAGTGGCTAAGAAAGCTAAGAAG
AAGGCCTCATCCAGTGACAGTGAGGACAGCAGCGAGGAGGAGGAGGAAGTTCAAGGGCCT
CCAGCAAAGAAGGCTGCTGTACCTGCCAAGCGAGTCGGTCTGCCTCCTGGGAAGGCTGCA
GCCAAAGCATCAGAGAGTAGCAGCAGTGAAGAGTCCAGTGATGATGATGATGAGGAGGAC
CAAAAGAAACAGCCTGTCCAGAAGGGAGTTAAGCCCCAAGCCAAGGCAGCCAAAGCTCCT
CCTAAGAAGGCCAAGAGCTCTGATTCTGATTCTGACTCAAGCTCCGAGGATGAGCCACCA
AAGAACCAGAAGCCAAAGATAACACCTGTGACAGTTAAAGCTCAGACTAAAGCCCCTCCC
AAACCAGCTCGAGCAGCACCTAAAATAGCCAATGGTAAAGCAGCCAGTAGCAGCAGTAGC
AGCAGCAGCAGCAGTAGCAGTGATGACTCAGAGGAGGAGAAGGCAGCAGCCACCCCCAAG
AAGGTCTGGACCATAACTTCTGTCAGGGCAGAGACTGTACCTAAAAAGCAAGTTGTGGCC
AAGGCCCCAGTGAAAGCAGCTACCACCCCTACCCGGAAGAGTTCTAGCAGTGAGGATTCC
TCCAGTGACGAGGAAGAGGAGCAAAAAAAACCCATGAAAAATAAACCAGGTCCCTACAGT
TCAGTCCCCCCGCCTTCTGCTCCCCCACCAAAGAAGTCTCTGGGAACCCAGCCTCCCAAG
AAGGCTGTGGAGAAGCAGCAGCCTGTGGAAAGCAGTGAAGACAGCAGTGATGAGTCTGAT
TCAAGTTCTGAAGAAGAGAAGAAACCCCCAACTAAGGCAGTAGTCTCTAAAGCAACCACT
AAACCACCTCCAGCAAAGAAAGCAGCAGAGAGCTCTTCAGACAGCTCAGACTCTGACAGC
TCTGAGGATGATGAAGCTCCTTCTAAGCCAGCTGGTACCACCAAGAATTCTTCAAATAAG
CCAGCTGTCACCACCAAGTCACCTGCAGTGAAGCCAGCTGCAGCCCCCAAGCAACCTGTG
GGCGGTGGCCAGAAGCTTCTGACGAGAAAGGCTGACAGCAGCTCCAGTGAGGAAGAGAGC
AGCTCCAGTGAGGAGGAGAAGACAAAGAAGATGGTGGCCACCACTAAGCCCAAGGCGACT
GCCAAAGCAGCTCTATCTCTGCCTGCCAAGCAGGCTCCTCAGGGTAGTAGGGACAGCAGC
TCTGATTCAGACAGCTCCAGCAGTGAGGAGGAGGAAGAGAAGACATCTAAGTCTGCAGTT
AAGAAGAAGCCACAGAAGGTAGCAGGAGGTGCAGCCCCTTCCAAGCCAGCCTCTGCAAAG
AAAGGAAAGGCTGAGAGCAGCAACAGTTCTTCTTCTGATGACTCCAGTGAGGAAGAGGAA
GAGAAGCTCAAGGGCAAGGGCTCTCCAAGACCACAAGCCCCCAAGGCCAATGGCACCTCT
GCACTGACTGCCCAGAATGGAAAAGCAGCTAAGAACAGTGAGGAGGAGGAAGAAGAAAAG
AAAAAGGCGGCAGTGGTAGTTTCCAAATCAGGTTCATTAAAGAAGCGGAAGCAGAATGAG
GCTGCCAAGGAGGCAGAGACTCCTCAGGCCAAGAAGATAAAGCTTCAGACCCCTAACACA
TTTCCAAAAAGGAAGAAAGGAGAAAAAAGGGCATCATCCCCATTCCGAAGGGTCAGGGAG
GAGGAAATTGAGGTGGATTCACGAGTTGCGGACAACTCCTTTGATGCCAAGCGAGGTGCA
GCCGGAGACTGGGGAGAGCGAGCCAATCAGGTTTTGAAGTTCACCAAAGGCAAGTCCTTT
CGGCATGAGAAAACCAAGAAGAAGCGGGGCAGCTACCGGGGAGGCTCAATCTCTGTCCAG
GTCAATTCTATTAAGTTTGACAGCGAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:15608
Chromosome Location10
LocusNot Available
References
  1. Pai CY, Chen HK, Sheu HL, Yeh NH: Cell-cycle-dependent alterations of a highly phosphorylated nucleolar protein p130 are associated with nucleologenesis. J Cell Sci. 1995 May;108 ( Pt 5):1911-20. 7657714
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Nomura N, Miyajima N, Sazuka T, Tanaka A, Kawarabayasi Y, Sato S, Nagase T, Seki N, Ishikawa K, Tabata S: Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1. DNA Res. 1994;1(1):27-35. 7584026
  5. Pai CY, Yeh NH: Cell proliferation-dependent expression of two isoforms of the nucleolar phosphoprotein p130. Biochem Biophys Res Commun. 1996 Apr 25;221(3):581-7. 8630004
  6. Chen HK, Yeh NH: The nucleolar phosphoprotein P130 is a GTPase/ATPase with intrinsic property to form large complexes triggered by F- and Mg2+. Biochem Biophys Res Commun. 1997 Jan 13;230(2):370-5. 9016786
  7. Chen HK, Pai CY, Huang JY, Yeh NH: Human Nopp140, which interacts with RNA polymerase I: implications for rRNA gene transcription and nucleolar structural organization. Mol Cell Biol. 1999 Dec;19(12):8536-46. 10567578
  8. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. 15144186
  9. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. 17081983
  10. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. 16964243
  11. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. 17924679
  12. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  13. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. 18318008
  14. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  15. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  16. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. 19608861
  17. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  18. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460
  19. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  20. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  21. Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC: Uncovering global SUMOylation signaling networks in a site-specific manner. Nat Struct Mol Biol. 2014 Oct;21(10):927-36. doi: 10.1038/nsmb.2890. Epub 2014 Sep 14. 25218447
  22. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. 25944712