You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMitogen-activated protein kinase 6
Synonyms
  • 2.7.11.24
  • ERK-3
  • ERK3
  • Extracellular signal-regulated kinase 3
  • MAP kinase 6
  • MAP kinase isoform p97
  • p97-MAPK
  • PRKM6
Gene NameMAPK6
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013387|Mitogen-activated protein kinase 6
MAEKFESLMNIHGFDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDPQSVK
HALREIKIIRRLDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLE
QGPLLEEHARLFMYQLLRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVVHEEDRQELLSVIPVYIRNDMTEPHKPLTQLLPGISREALDFLEQILTFS
PMDRLTAEEALSHPYMSIYSFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWERYHDC
QFSEHDWPVHNNFDIDEVQLDPRALSDVTDEEEVQVDPRKYLDGDREKYLEDPAFDTNYS
TEPCWQYSDHHENKYCDLECSHTCNYKTRSSSYLDNLVWRESEVNHYYEPKLIIDLSNWK
EQSKEKSDKKGKSKCERNGLVKAQIALEEASQQLAGKEREKNQGFDFDSFIAGTIQLSSQ
HEPTDVVDKLNDLNSSVSQLELKSLISKSVSQEKQEKGMANLAQLEALYQSSWDSQFVSG
GEDCFFINQFCEVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEG
FLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHL
N
Number of residues721
Molecular Weight82680.11
Theoretical pINot Available
GO Classification
Functions
  • ATP binding
  • protein serine/threonine kinase activity
  • MAP kinase activity
Processes
  • MAPK cascade
  • protein phosphorylation
  • signal transduction
  • cell cycle
Components
  • nucleoplasm
  • cytoplasm
  • nucleus
  • cytosol
General FunctionProtein serine/threonine kinase activity
Specific FunctionAtypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction with atypical MAPKAPK5, ERK3/MAPK6 is phosphorylated at Ser-189 and then mediates phosphorylation and activation of MAPKAPK5, which in turn phosphorylates ERK3/MAPK6. May promote entry in the cell cycle (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ16659
UniProtKB Entry NameMK06_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013388|Mitogen-activated protein kinase 6 (MAPK6)
ATGGCAGAGAAATTTGAAAGTCTCATGAACATTCATGGTTTTGATCTGGGTTCTAGGTAT
ATGGACTTAAAACCATTGGGTTGTGGAGGCAATGGCTTGGTTTTTTCTGCTGTAGACAAT
GACTGTGACAAAAGAGTAGCCATCAAGAAAATTGTCCTTACTGATCCCCAGAGTGTCAAA
CATGCTCTACGTGAAATCAAAATTATTAGAAGACTTGACCATGATAACATTGTGAAAGTG
TTTGAGATTCTTGGTCCCAGTGGAAGCCAATTAACAGACGATGTGGGCTCTCTTACGGAA
CTGAACAGTGTTTACATTGTTCAGGAGTACATGGAGACAGACTTGGCTAATGTGCTGGAG
CAGGGCCCTTTACTGGAAGAGCATGCCAGGCTTTTCATGTATCAGCTGCTACGGGGGCTC
AAGTATATTCACTCTGCAAATGTACTGCACAGAGATCTCAAACCAGCTAATCTTTTCATT
AATACGGAAGACTTGGTGCTGAAGATAGGTGACTTTGGTCTTGCACGGATCATGGATCCT
CATTATTCCCATAAGGGTCATCTTTCTGAAGGATTGGTTACTAAATGGTACAGATCTCCA
CGTCTTTTACTTTCTCCTAATAATTATACTAAAGCCATTGACATGTGGGCTGCAGGCTGC
ATCTTTGCTGAAATGCTGACTGGTAAAACCCTTTTTGCAGGTGCACATGAACTTGAACAG
ATGCAGCTGATTTTAGAATCTATTCCTGTTGTACATGAGGAAGATCGTCAGGAGCTTCTC
AGCGTAATTCCAGTTTACATTAGAAATGACATGACTGAGCCACACAAACCTTTAACTCAG
CTGCTTCCAGGAATTAGTCGAGAAGCACTGGATTTCCTGGAACAAATTTTGACATTTAGC
CCCATGGATCGGTTAACAGCAGAAGAAGCACTCTCCCATCCTTACATGAGCATATATTCT
TTTCCAATGGATGAGCCAATTTCAAGCCATCCTTTTCATATTGAAGATGAAGTTGATGAT
ATTTTGCTTATGGATGAAACTCACAGTCACATTTATAACTGGGAAAGGTATCATGATTGT
CAGTTTTCAGAGCATGATTGGCCTGTACATAACAACTTTGATATTGATGAAGTTCAGCTT
GATCCAAGAGCTCTGTCCGATGTCACTGATGAAGAAGAAGTACAAGTTGATCCCCGAAAA
TATTTGGATGGAGATCGGGAAAAGTATCTGGAGGATCCTGCTTTTGATACCAATTACTCT
ACTGAGCCTTGTTGGCAATACTCAGATCATCATGAAAACAAATATTGTGATCTGGAGTGT
AGCCATACTTGTAACTACAAAACGAGGTCATCATCATATTTAGATAACTTAGTTTGGAGA
GAGAGTGAAGTTAACCATTACTATGAACCCAAGCTTATTATAGATCTTTCCAATTGGAAA
GAACAAAGCAAAGAAAAATCTGATAAGAAAGGCAAATCAAAATGTGAAAGGAATGGATTG
GTTAAAGCCCAGATAGCGCTAGAGGAAGCATCACAGCAACTGGCTGGAAAAGAAAGGGAA
AAGAATCAGGGATTTGATTTTGATTCCTTTATTGCAGGAACTATTCAGCTTAGTTCCCAG
CATGAGCCTACTGATGTTGTTGATAAATTAAATGACTTGAATAGCTCAGTGTCCCAACTA
GAATTGAAAAGTTTGATATCAAAGTCAGTAAGCCAAGAAAAACAGGAAAAAGGAATGGCA
AATCTGGCTCAATTAGAAGCCTTGTACCAGTCTTCTTGGGACAGCCAGTTTGTGAGTGGT
GGGGAGGACTGTTTTTTCATAAATCAGTTTTGTGAGGTAAGGAAGGATGAACAAGTTGAG
AAGGAAAACACTTACACTAGTTACTTGGACAAGTTCTTTAGCAGGAAAGAAGATACTGAA
ATGCTAGAAACTGAGCCAGTAGAGGATGGGAAGCTTGGGGAGAGAGGACATGAGGAAGGA
TTTCTGAACAACAGTGGGGAGTTCCTCTTTAACAAGCAGCTCGAGTCCATAGGCATCCCA
CAGTTTCACAGTCCAGTTGGGTCACCACTTAAGTCAATACAGGCCACATTAACACCTTCT
GCTATGAAATCTTCCCCTCAAATTCCTCATCAAACATACAGCAGCATTCTGAAACATCTG
AACTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6879
Chromosome Location15
LocusNot Available
References
  1. Zhu AX, Zhao Y, Moller DE, Flier JS: Cloning and characterization of p97MAPK, a novel human homolog of rat ERK-3. Mol Cell Biol. 1994 Dec;14(12):8202-11. 7969157
  2. Meloche S, Beatty BG, Pellerin J: Primary structure, expression and chromosomal locus of a human homolog of rat ERK3. Oncogene. 1996 Oct 3;13(7):1575-9. 8875998
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  5. Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. 19054851
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Coulombe P, Rodier G, Bonneil E, Thibault P, Meloche S: N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome. Mol Cell Biol. 2004 Jul;24(14):6140-50. 15226418
  8. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  9. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. 19369195
  10. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  11. Deleris P, Trost M, Topisirovic I, Tanguay PL, Borden KL, Thibault P, Meloche S: Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway. J Biol Chem. 2011 Feb 25;286(8):6470-8. doi: 10.1074/jbc.M110.181529. Epub 2010 Dec 22. 21177870
  12. Martinez-Noel G, Galligan JT, Sowa ME, Arndt V, Overton TM, Harper JW, Howley PM: Identification and proteomic analysis of distinct UBE3A/E6AP protein complexes. Mol Cell Biol. 2012 Aug;32(15):3095-106. doi: 10.1128/MCB.00201-12. Epub 2012 May 29. 22645313
  13. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. 17344846