You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein phosphatase 1 regulatory subunit 3A
Synonyms
  • PP1G
  • Protein phosphatase 1 glycogen-associated regulatory subunit
  • Protein phosphatase type-1 glycogen targeting subunit
  • RG1
Gene NamePPP1R3A
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009128|Protein phosphatase 1 regulatory subunit 3A
MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSG
TRRVSFADSFGFNLVSVKEFDCWELPSASTTFDLGTDIFHTEEYVLAPLFDLPSSKEDLM
QQLQIQKAILESTESLLGSTSIKGIIRVLNVSFEKLVYVRMSLDDWQTHYDILAEYVPNS
CDGETDQFSFKIVLVPPYQKDGSKVEFCIRYETSVGTFWSNNNGTNYTFICQKKEQEPEP
VKPWKEVPNRQIKGCLKVKSSKEESSVTSEENNFENPKNTDTYIPTIICSHEDKEDLEAS
NRNVKDVNREHDEHNEKELELMINQHLIRTRSTASRDERNTFSTDPVNFPNKAEGLEKKQ
IHGEICTDLFQRSLSPSSSAESSVKGDFYCNEKYSSGDDCTHQPSEETTSNMGEIKPSLG
DTSSDELVQLHTGSKEVLDDNANPAHGNGTVQIPCPSSDQLMAGNLNKKHEGGAKNIEVK
DLGCLRRDFHSDTSACLKESTEEGSSKEDYYGNGKDDEEQRIYLGVNEKQRKNFQTILHD
QERKMGNPKISVAGIGASNRDLATLLSEHTAIPTRAITADVSHSPRTNLSWEEAVLTPEH
HHLTSEGSALGGITGQVCSSRTGNVLRNDYLFQVEEKSGGINSEDQDNSPQHKQSWNVLE
SQGKSRENKTNITEHIKGQTDCEDVWGKRDNTRSLKATTEELFTCQETVCCELSSLADHG
ITEKAEAGTAYIIKTTSESTPESMSAREKAIIAKLPQETARSDRPIEVKETAFDPHEGRN
DDSHYTLCQRDTVGVIYDNDFEKESRLGICNVRVDEMEKEETMSMYNPRKTHDREKCGTG
NITSVEESSWVITEYQKATSKLDLQLGMLPTDKTVFSENRDLRQVQELSKKTDSDAIVHS
AFNSDTNRAPQNSSPFSKHHTEISVSTNEQAIAVENAVTTMASQPISTKSENICNSTREI
QGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLEN
MEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFSKYTNSKIPYFL
LFLIFLITVYHYDLMIGLTFYVLSLSWLSWEEGRQKESVKKK
Number of residues1122
Molecular Weight125765.695
Theoretical pINot Available
GO Classification
Processes
  • glycogen metabolic process
Components
  • integral component of membrane
General FunctionNot Available
Specific FunctionSeems to act as a glycogen-targeting subunit for PP1. PP1 is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Plays an important role in glycogen synthesis but is not essential for insulin activation of glycogen synthase (By similarity).
Pfam Domain Function
Transmembrane Regions1078-1098
GenBank Protein IDNot Available
UniProtKB IDQ16821
UniProtKB Entry NamePPR3A_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0017696|Protein phosphatase 1 regulatory subunit 3A (PPP1R3A)
ATGGAGCCTTCTGAAGTACCTAGTCAGATTAGCAAAGATAATTTTTTAGAAGTTCCTAAT
TTATCTGACTCTCTTTGTGAAGATGAAGAAGTTACTTTCCAACCTGGTTTCTCCCCTCAA
CCAAGTAGACGAGGTTCTGATTCTTCTGAAGACATATACCTGGATACCCCATCTTCAGGT
ACTAGAAGAGTTTCATTTGCTGATTCCTTTGGATTCAATCTTGTGTCTGTTAAAGAATTT
GATTGCTGGGAATTACCGAGTGCTTCAACCACTTTTGACTTAGGGACGGACATTTTCCAC
ACAGAAGAATATGTTTTAGCCCCACTGTTTGACTTGCCTTCTTCAAAAGAAGATCTTATG
CAACAACTCCAAATACAGAAAGCAATACTGGAGTCAACTGAGTCTCTTCTTGGGTCTACA
AGTATCAAGGGTATTATTCGAGTTTTGAATGTTTCTTTTGAGAAGTTAGTATATGTAAGA
ATGTCTTTAGATGACTGGCAGACACATTATGACATTTTAGCAGAATATGTTCCTAATTCA
TGTGATGGTGAAACTGACCAGTTCTCCTTTAAGATTGTATTGGTTCCTCCTTATCAAAAA
GATGGCAGTAAAGTTGAGTTTTGTATACGTTATGAAACTTCTGTTGGTACATTTTGGTCA
AATAATAATGGCACAAATTATACATTCATTTGTCAAAAGAAAGAACAAGAGCCGGAGCCT
GTAAAACCATGGAAAGAAGTTCCTAACAGACAAATAAAAGGCTGCTTAAAGGTAAAATCA
AGTAAAGAAGAATCATCAGTAACATCAGAAGAAAATAACTTTGAGAATCCAAAGAATACA
GATACCTATATCCCAACAATCATTTGTTCTCATGAGGACAAGGAAGATTTGGAAGCCAGT
AATCGAAATGTAAAAGATGTAAACAGGGAACATGATGAACATAATGAAAAAGAATTAGAG
TTGATGATAAATCAACACTTAATAAGAACCAGAAGTACTGCTTCCAGAGATGAAAGGAAT
ACATTTTCAACAGATCCAGTCAATTTTCCAAATAAAGCAGAGGGGTTAGAGAAGAAGCAA
ATCCATGGTGAAATATGTACTGACTTGTTCCAAAGGTCTCTGTCTCCAAGTTCATCAGCA
GAAAGCTCCGTAAAGGGAGATTTTTACTGCAATGAAAAATATTCCTCAGGAGATGACTGT
ACACATCAACCTTCAGAGGAAACTACTTCAAATATGGGAGAAATCAAGCCATCATTGGGA
GATACTAGTAGTGATGAACTAGTGCAATTACATACTGGCAGCAAAGAAGTCCTGGATGAT
AATGCTAATCCAGCCCATGGCAATGGCACAGTGCAAATACCTTGCCCCTCTTCAGATCAA
CTAATGGCAGGAAACCTTAATAAAAAACATGAAGGAGGAGCTAAAAATATTGAAGTAAAA
GATTTGGGATGTTTACGAAGAGATTTCCATTCAGATACGTCGGCATGTCTCAAAGAATCA
ACAGAAGAAGGATCTTCTAAGGAAGATTATTATGGCAATGGTAAGGATGATGAAGAACAA
AGAATATATTTAGGTGTTAATGAAAAACAAAGAAAAAATTTCCAAACAATCTTACATGAC
CAAGAAAGGAAGATGGGTAACCCTAAAATAAGTGTGGCAGGGATTGGAGCTAGTAACAGA
GACCTGGCTACTCTGCTGAGCGAACATACCGCAATCCCCACCCGGGCAATCACAGCAGAT
GTGTCTCATTCACCAAGGACAAATTTAAGTTGGGAAGAAGCTGTGTTAACCCCAGAGCAT
CATCATTTGACTAGTGAAGGCAGCGCTTTAGGAGGGATAACTGGTCAAGTTTGTTCATCA
AGAACTGGAAATGTTTTGAGGAATGATTATCTTTTCCAAGTTGAAGAAAAATCAGGTGGG
ATTAATTCTGAAGATCAGGATAATAGCCCACAGCATAAACAAAGTTGGAATGTTCTGGAA
AGTCAGGGAAAATCAAGAGAGAATAAGACAAACATAACAGAGCATATCAAAGGACAAACA
GATTGTGAAGACGTGTGGGGAAAAAGAGATAATACGAGGAGTTTGAAAGCTACTACAGAA
GAATTGTTTACCTGCCAAGAAACAGTGTGCTGTGAACTGTCTTCTCTAGCTGATCATGGC
ATTACTGAGAAAGCAGAAGCTGGTACAGCCTATATAATTAAGACAACATCAGAAAGTACT
CCAGAAAGCATGTCTGCTAGAGAAAAAGCAATAATTGCTAAGCTACCTCAAGAGACAGCA
CGAAGTGACAGGCCCATCGAGGTAAAGGAAACAGCGTTTGATCCACATGAAGGGAGAAAT
GATGATTCACATTATACCCTTTGTCAACGAGATACAGTAGGTGTAATCTATGACAATGAT
TTTGAAAAGGAATCACGTTTAGGTATTTGTAATGTACGTGTAGATGAAATGGAGAAGGAA
GAAACCATGTCTATGTACAATCCTAGGAAGACACATGACAGGGAGAAATGTGGCACTGGA
AATATAACATCTGTGGAAGAATCCTCATGGGTCATTACAGAATATCAAAAAGCAACTTCA
AAACTGGATTTACAGTTGGGAATGTTACCAACAGACAAAACTGTATTTTCAGAAAACAGA
GATCTTAGGCAGGTTCAAGAATTATCAAAGAAAACAGACTCGGATGCCATTGTGCATTCT
GCTTTTAACTCAGACACTAATAGAGCTCCTCAGAATAGCTCTCCTTTTTCCAAACATCAT
ACTGAAATTTCAGTGTCAACTAATGAGCAGGCAATTGCTGTAGAGAATGCAGTTACTACC
ATGGCTAGCCAACCTATTTCTACGAAATCAGAAAATATTTGTAATTCAACAAGAGAAATC
CAGGGTATTGAGAAGCACCCTTATCCTGAGTCTAAACCTGAAGAAGTTTCCAGAAGTTCA
GGAATAGTGACATCAGGTAGTAGAAAAGAAAGATGCATAGGCCAGATTTTCCAAACAGAA
GAGTATAGTGTGGAAAAATCTCTAGGGCCAATGATTTTAATCAACAAACCTCTTGAGAAT
ATGGAAGAAGCAAGGCATGAAAATGAAGGATTAGTAAGCTCTGGGCAATCACTATACACT
TCAGGTGAAAAGGAATCTGACAGCTCTGCTTCTACTAGTCTTCCTGTTGAGGAAAGTCAA
GCTCAAGGCAACGAATCTTTGTTTTCAAAATATACCAACTCTAAAATACCTTATTTCCTT
TTGTTTCTGATATTTCTTATAACTGTCTACCATTATGACTTAATGATTGGCTTGACATTC
TACGTTTTGTCATTGTCCTGGCTATCCTGGGAAGAGGGTAGACAAAAAGAGTCTGTCAAA
AAGAAGTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9291
Chromosome Location7
LocusNot Available
References
  1. Xia J, Scherer SW, Cohen PT, Majer M, Xi T, Norman RA, Knowler WC, Bogardus C, Prochazka M: A common variant in PPP1R3 associated with insulin resistance and type 2 diabetes. Diabetes. 1998 Sep;47(9):1519-24. 9726244
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. 12853948
  3. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. 12690205
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Chen YH, Hansen L, Chen MX, Bjorbaek C, Vestergaard H, Hansen T, Cohen PT, Pedersen O: Sequence of the human glycogen-associated regulatory subunit of type 1 protein phosphatase and analysis of its coding region and mRNA level in muscle from patients with NIDDM. Diabetes. 1994 Oct;43(10):1234-41. 7926294
  6. Hansen L, Hansen T, Vestergaard H, Bjorbaek C, Echwald SM, Clausen JO, Chen YH, Chen MX, Cohen PT, Pedersen O: A widespread amino acid polymorphism at codon 905 of the glycogen-associated regulatory subunit of protein phosphatase-1 is associated with insulin resistance and hypersecretion of insulin. Hum Mol Genet. 1995 Aug;4(8):1313-20. 7581368
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974