You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameReceptor-type tyrosine-protein phosphatase O
Synonyms
  • 3.1.3.48
  • GLEPP1
  • Glomerular epithelial protein 1
  • Protein tyrosine phosphatase U2
  • PTP-U2
  • PTPase U2
  • PTPU2
  • R-PTP-O
Gene NamePTPRO
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009013|Receptor-type tyrosine-protein phosphatase O
MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKI
TGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLP
VTSVSIYDYKPSPETGVLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNH
WLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNW
EEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWW
DSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDG
FHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSF
YISPSGEWIEELTEKPQHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQR
LEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYP
LGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVRIANLLP
AWYYNFRVTMVTWGDPELSCCDSSTISFITAPVAPEITSVEYFNSLLYISWTYGDDTTDL
SHSRMLHWMVVAEGKKKIKKSVTRNVMTAILSLPPGDIYNLSVTACTERGSNTSMLRLVK
LEPAPPKSLFAVNKTQTSVTLLWVEEGVADFFEVFCQQVGSSQKTKLQEPVAVSSHVVTI
SSLLPATAYNCSVTSFSHDSPSVPTFIAVSTMVTEMNPNVVVISVLAILSTLLIGLLLVT
LIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFY
INPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLP
LNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRND
FWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRH
FRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGV
GRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKK
QQFCISDVIYENVSKS
Number of residues1216
Molecular Weight138342.845
Theoretical pINot Available
GO Classification
Functions
  • transmembrane receptor protein tyrosine phosphatase activity
  • Wnt-protein binding
  • protein tyrosine phosphatase activity
  • protein homodimerization activity
  • phosphatase activity
Processes
  • peptidyl-tyrosine dephosphorylation
  • glomerulus development
  • negative regulation of cell-substrate adhesion
  • negative regulation of neuron projection development
  • glomerular visceral epithelial cell differentiation
  • lamellipodium assembly
  • protein dephosphorylation
  • negative regulation of retinal ganglion cell axon guidance
  • slit diaphragm assembly
  • regulation of glomerular filtration
  • monocyte chemotaxis
  • negative regulation of canonical Wnt signaling pathway
  • cell morphogenesis
  • negative regulation of glomerular filtration
  • axon guidance
Components
  • integral component of plasma membrane
  • neuron projection
  • apical plasma membrane
  • growth cone
  • lateral plasma membrane
  • dendritic spine
  • plasma membrane
  • axon
  • integral component of membrane
  • extracellular exosome
  • lamellipodium
General FunctionWnt-protein binding
Specific FunctionPossesses tyrosine phosphatase activity. Plays a role in regulating the glomerular pressure/filtration rate relationship through an effect on podocyte structure and function (By similarity).
Pfam Domain Function
Transmembrane Regions823-843
GenBank Protein IDNot Available
UniProtKB IDQ16827
UniProtKB Entry NamePTPRO_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013563|Receptor-type tyrosine-protein phosphatase O (PTPRO)
ATGGGGCACCTGCCCACGGGGATACACGGCGCCCGCCGCCTCCTGCCTCTGCTCTGGCTC
TTTGTGCTGTTCAAGAATGCTACAGCTTTCCATGTAACTGTCCAAGATGATAATAACATC
GTTGTCTCATTAGAAGCTTCAGACGTCATCAGTCCAGCATCTGTGTATGTTGTGAAGATA
ACTGGTGAATCCAAAAATTATTTCTTCGAATTTGAGGAATTCAACAGCACTTTGCCTCCT
CCTGTTATTTTCAAGGCCAGTTATCATGGCCTTTATTATATAATCACTCTGGTAGTGGTA
AATGGAAATGTGGTGACCAAGCCATCCAGATCAATCACTGTGTTAACAAAACCTCTACCT
GTAACCAGTGTTTCCATATATGACTATAAACCTTCTCCTGAAACAGGAGTCCTGTTTGAA
ATACATTATCCAGAAAAATATAACGTTTTCACAAGAGTGAACATTAGCTACTGGGAAGGT
AAAGACTTCCGGACAATGCTATATAAAGATTTCTTTAAGGGAAAAACAGTATTTAATCAC
TGGCTGCCAGGAATGTGTTATAGTAATATCACCTTTCAGCTGGTATCTGAGGCAACTTTT
AATAAAAGTACCCTTGTTGAGTACAGTGGTGTCAGTCACGAACCCAAACAGCACAGAACT
GCCCCTTATCCACCTCAAAATATTTCCGTTCGTATCGTAAACTTGAACAAAAACAACTGG
GAAGAACAGAGTGGCAATTTCCCAGAAGAATCCTTCATGAGATCACAAGATACAATAGGA
AAAGAAAAACTCTTCCATTTTACAGAAGAAACCCCTGAAATTCCCTCGGGCAACATTTCT
TCCGGTTGGCCTGATTTTAATAGCAGTGACTATGAAACTACGTCTCAGCCATATTGGTGG
GACAGTGCATCTGCAGCTCCTGAAAGTGAAGATGAATTTGTCAGCGTACTTCCCATGGAA
TACGAAAATAACAGTACACTCAGTGAGACAGAGAAGTCAACATCAGGCTCTTTCTCCTTT
TTCCCTGTGCAAATGATATTGACCTGGTTACCACCCAAACCACCCACTGCTTTTGATGGG
TTCCATATCCATATTGAACGAGAAGAGAACTTTACTGAATATTTGATGGTGGATGAAGAA
GCACATGAATTTGTTGCAGAACTGAAGGAACCTGGGAAATATAAGTTATCTGTGACAACC
TTTAGTTCCTCAGGATCTTGTGAAACTCGAAAAAGTCAGTCAGCAAAATCACTCAGCTTT
TATATCAGTCCTTCAGGAGAGTGGATTGAAGAACTGACCGAGAAGCCGCAGCACGTGAGT
GTCCACGTTTTAAGCTCAACCACTGCCTTGATGTCCTGGACATCTTCCCAAGAGAACTAC
AACAGCACCATTGTGTCTGTGGTGTCGCTGACCTGCCAGAAACAAAAGGAGAGCCAGAGG
CTTGAAAAGCAGTACTGCACTCAGGTGAACTCAAGCAAACCTATTATTGAAAATCTGGTT
CCTGGTGCCCAGTACCAGGTTGTAATATACCTAAGGAAAGGCCCTTTGATTGGACCACCT
TCAGATCCTGTGACATTTGCTATTGTTCCCACAGGAATAAAGGATTTAATGCTCTATCCT
TTGGGTCCTACGGCCGTGGTTCTGAGCTGGACCAGACCTTATTTAGGCGTGTTCAGAAAA
TACGTGGTTGAAATGTTTTATTTCAACCCTGCTACAATGACATCAGAGTGGACCACCTAC
TATGAAATAGCAGCAACTGTTTCCTTAACTGCATCCGTGAGAATAGCTAATCTGCTGCCA
GCATGGTACTACAACTTCCGGGTTACCATGGTGACGTGGGGAGATCCAGAATTGAGCTGC
TGTGACAGCTCTACCATCAGCTTCATAACAGCCCCAGTGGCTCCGGAAATCACTTCTGTG
GAATATTTCAACAGTCTGTTATATATCAGTTGGACATATGGGGATGATACAACGGACTTG
TCCCATTCTAGAATGCTTCACTGGATGGTGGTTGCAGAAGGAAAAAAGAAAATTAAAAAG
AGTGTAACACGCAATGTCATGACTGCAATTCTCAGCTTGCCTCCAGGCGACATCTATAAC
CTCTCAGTAACTGCTTGTACTGAAAGAGGAAGTAATACCTCCATGCTCCGCCTTGTCAAG
CTAGAACCAGCTCCACCCAAATCACTCTTCGCAGTGAACAAAACCCAGACTTCAGTGACT
TTGCTGTGGGTGGAAGAGGGAGTAGCTGATTTCTTTGAAGTTTTCTGTCAACAAGTTGGC
TCCAGTCAGAAAACCAAACTTCAGGAACCAGTTGCTGTTTCTTCCCATGTCGTGACCATC
TCCAGCCTTCTTCCTGCCACTGCCTACAATTGTAGTGTCACCAGCTTTAGCCATGACAGC
CCCAGTGTCCCTACGTTCATAGCCGTCTCAACAATGGTTACAGAGATGAATCCCAATGTG
GTAGTGATCTCCGTGCTGGCCATCCTTAGCACACTTTTAATTGGACTGTTGCTTGTTACC
CTCATTATTCTTAGGAAAAAGCATCTGCAGATGGCTAGGGAGTGTGGAGCTGGTACATTT
GTCAATTTTGCATCCTTAGAGAGGGATGGAAAGCTTCCATACAACTGGAGTAAAAATGGT
TTAAAGAAGAGGAAACTGACAAACCCGGTTCAACTGGATGACTTTGATGCCTATATTAAG
GATATGGCCAAAGACTCTGACTATAAATTTTCTCTTCAGTTTGAGGAGTTGAAATTGATT
GGACTGGATATCCCACACTTTGCTGCAGATCTTCCACTGAATCGATGTAAAAACCGTTAC
ACAAACATCCTACCATATGACTTCAGCCGTGTGAGATTAGTCTCCATGAATGAAGAGGAA
GGTGCAGACTACATCAATGCCAACTATATTCCTGGATACAACTCACCCCAGGAGTATATT
GCCACCCAGGGGCCACTGCCTGAAACCAGAAATGACTTCTGGAAGATGGTCCTGCAACAA
AAGTCTCAGATTATTGTCATGCTCACTCAGTGTAATGAGAAAAGGAGGGTGAAATGTGAC
CATTACTGGCCATTCACGGAAGAACCTATAGCCTATGGAGACATCACTGTGGAGATGATT
TCAGAGGAAGAGCAGGACGACTGGGCCTGTAGACACTTCCGGATCAACTATGCTGACGAG
ATGCAGGATGTGATGCATTTTAACTACACTGCATGGCCTGATCATGGTGTGCCCACAGCA
AATGCTGCAGAAAGTATCCTGCAGTTTGTACACATGGTCCGACAGCAAGCTACCAAGAGC
AAAGGTCCCATGATCATTCACTGCAGTGCTGGCGTGGGACGGACAGGAACATTCATTGCC
CTGGACAGGCTCTTGCAGCACATTCGGGATCATGAGTTTGTTGACATCTTAGGGCTGGTG
TCAGAAATGAGGTCATACCGGATGTCTATGGTACAGACAGAGGAGCAGTACATTTTTATC
CATCAGTGTGTGCAACTGATGTGGATGAAGAAGAAGCAGCAGTTCTGCATCAGTGATGTC
ATATACGAGAATGTTAGCAAGTCCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:9678
Chromosome Location12
LocusNot Available
References
  1. Seimiya H, Sawabe T, Inazawa J, Tsuruo T: Cloning, expression and chromosomal localization of a novel gene for protein tyrosine phosphatase (PTP-U2) induced by various differentiation-inducing agents. Oncogene. 1995 May 4;10(9):1731-8. 7753550
  2. Wiggins RC, Wiggins JE, Goyal M, Wharram BL, Thomas PE: Molecular cloning of cDNAs encoding human GLEPP1, a membrane protein tyrosine phosphatase: characterization of the GLEPP1 protein distribution in human kidney and assignment of the GLEPP1 gene to human chromosome 12p12-p13. Genomics. 1995 May 1;27(1):174-81. 7665166
  3. Aguiar RC, Yakushijin Y, Kharbanda S, Tiwari S, Freeman GJ, Shipp MA: PTPROt: an alternatively spliced and developmentally regulated B-lymphoid phosphatase that promotes G0/G1 arrest. Blood. 1999 Oct 1;94(7):2403-13. 10498613
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  5. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. 16541075
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Ozaltin F, Ibsirlioglu T, Taskiran EZ, Baydar DE, Kaymaz F, Buyukcelik M, Kilic BD, Balat A, Iatropoulos P, Asan E, Akarsu NA, Schaefer F, Yilmaz E, Bakkaloglu A: Disruption of PTPRO causes childhood-onset nephrotic syndrome. Am J Hum Genet. 2011 Jul 15;89(1):139-47. doi: 10.1016/j.ajhg.2011.05.026. Epub 2011 Jun 30. 21722858
  8. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. 19167335
  9. Almo SC, Bonanno JB, Sauder JM, Emtage S, Dilorenzo TP, Malashkevich V, Wasserman SR, Swaminathan S, Eswaramoorthy S, Agarwal R, Kumaran D, Madegowda M, Ragumani S, Patskovsky Y, Alvarado J, Ramagopal UA, Faber-Barata J, Chance MR, Sali A, Fiser A, Zhang ZY, Lawrence DS, Burley SK: Structural genomics of protein phosphatases. J Struct Funct Genomics. 2007 Sep;8(2-3):121-40. Epub 2007 Dec 5. 18058037