You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTyrosine-protein phosphatase non-receptor type 20
Synonyms
  • 3.1.3.48
  • hPTPN20
  • PTPN20A
  • PTPN20B
Gene NamePTPN20
OrganismHuman
Amino acid sequence
>lcl|BSEQ0037284|Tyrosine-protein phosphatase non-receptor type 20
MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRN
FPHNDYEDVFEEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVS
EGELDQLAQIRPLIFNFHEQTAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQ
PSNREKNRYRDILPYDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFW
QMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMF
QVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRT
GVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD
Number of residues420
Molecular Weight48422.455
Theoretical pINot Available
GO Classification
Functions
  • protein tyrosine phosphatase activity
Components
  • microtubule organizing center
  • cytoplasm
  • microtubule
  • nucleus
General FunctionProtein tyrosine phosphatase activity
Specific FunctionTyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ4JDL3
UniProtKB Entry NamePTN20_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0019699|Tyrosine-protein phosphatase non-receptor type 20 (PTPN20)
ATGTCTTCACCTAGGGACTTTAGAGCAGAGCCTGTAAACGATTATGAGGGAAATGACTCT
GAAGCAGAAGACTTGAATTTCAGGGAGACTTTGCCTTCATCAAGTCAGGAAAACACACCT
AGATCAAAGGTTTTTGAAAATAAAGTTAATTCAGAGAAGGTAAAACTTTCTCTTCGGAAT
TTCCCACATAATGATTATGAGGATGTTTTTGAAGAGCCTTCAGAAAGTGGCAGTGATCCC
AGCATGTGGACAGCCAGAGGCCCCTTCAGAAGAGACAGGTGGAGCAGTGAGGATGAGGAG
GCTGCAGGGCCATCACAGGCTCTCTCCCCTCTACTTTCTGATACGCGCAAAATTGTTTCT
GAAGGAGAACTAGATCAGTTGGCTCAGATTCGGCCATTAATATTCAATTTTCATGAGCAG
ACAGCCATCAAGGATTGTTTGAAAATCCTTGAGGAAAAAACAGCAGCGTATGATATCATG
CAGGAATTTATGGCTTTAGAACTTAAGAATCTGCCTGGTGAGTTCAACTCTGGGAATCAA
CCAAGCAACAGAGAAAAAAATAGATACCGAGATATTCTTCCATATGATTCAACACGCGTT
CCTCTTGGAAAAAGCAAGGACTACATCAATGCTAGTTATATTAGAATAGTCAATTGTGGA
GAAGAGTATTTTTATATCGCTACTCAAGGACCACTGCTGAGCACCATAGATGACTTTTGG
CAAATGGTGTTGGAAAATAATTCAAATGTTATTGCCATGATAACCAGAGAGATAGAAGGT
GGAATTATCAAATGCTACCATTACTGGCCCATTTCTCTGAAGAAGCCATTGGAATTGAAA
CACTTCCGTGTATTCCTGGAGAACTACCAGATACTTCAATATTTCATCATTCGAATGTTT
CAAGTTGTGGAGAAGTCCACGGGAACTAGTCACTCTGTAAAACAGTTGCAGTTCACCAAG
TGGCCAGACCATGGCACTCCTGCCTCAGCAGATAGCTTCATAAAATATATTCGTTATGCA
AGGAAGAGCCACCTTACAGGACCCATGGTTGTTCACTGCAGTGCCGGCATAGGCCGGACA
GGGGTGTTCCTATGTGTGGATGTCGTGTTCTGTGCCATCGTAAAGAACTGTTCATTCAAC
ATCATGGATATAGTGGCCCAAATGAGAGAACAACGTTCTGGCATGGTTCAAACGAAGGAG
CAGTATCACTTTTGTTACGATATTGTGCTTGAAGTTCTTCGGAAACTTCTGACTTTGGAT
TAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:23423
Chromosome Location10
LocusNot Available
References
  1. Fodero-Tavoletti MT, Hardy MP, Cornell B, Katsis F, Sadek CM, Mitchell CA, Kemp BE, Tiganis T: Protein tyrosine phosphatase hPTPN20a is targeted to sites of actin polymerization. Biochem J. 2005 Jul 15;389(Pt 2):343-54. 15790311
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. 15164054
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334