You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAlpha-1,4 glucan phosphorylase
Synonyms
  • 2.4.1.1
Gene NameNot Available
OrganismHuman
Amino acid sequence
>lcl|BSEQ0011562|Alpha-1,4 glucan phosphorylase
IPAFACAAAFLLHLFSSASAGAMAKPLTDSEKRKQISVRGLAGLGDVAEVRKSFNRHLHF
TLVKDRNVATPRDYFFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQN
TMVNLGLQNACDEAIYQLGLDLEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGY
GIRYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLD
TQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENISR
VLYPNDNFFEGKELRLKQEYFVVASTLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAIQL
NDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKLLP
RHLEIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGVAR
IHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLANTIVEKIGEEFLTDLSQ
LKKLLPLVSDEVFIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKRQL
LNCLHVVTLYNRIKRDPAKAFVPRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDPVVG
DRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDGANV
EMAEEAGAENLFIFGLRVEDVEALDRKGYNAREYYDHLPELKQAVDQISSGFFSPKEPDC
FKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSSDRTI
TEYAREIWGVEPSDLQIPPPNIPRD
Number of residues865
Molecular Weight98828.62
Theoretical pI6.95
GO Classification
Functions
  • pyridoxal phosphate binding
  • glycogen phosphorylase activity
Processes
  • carbohydrate metabolic process
General FunctionPyridoxal phosphate binding
Specific FunctionPhosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID62087740
UniProtKB IDQ59GM9
UniProtKB Entry NameQ59GM9_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0004229|2599 bp
CATCCCGGCGTTCGCGTGTGCCGCCGCTTTCCTCCTCCATCTCTTTTCCTCCGCCTCCGC
CGGCGCGATGGCGAAGCCGCTGACGGACAGCGAGAAGCGGAAGCAGATCAGCGTGCGCGG
CCTGGCGGGGCTAGGCGACGTGGCCGAGGTGCGGAAGAGCTTCAACCGGCACTTGCACTT
CACGCTGGTCAAGGACCGCAATGTGGCCACGCCCCGCGACTACTTCTTCGCGCTGGCGCA
CACGGTGCGCGACCACCTCGTGGGCCGCTGGATCCGCACGCAGCAGCACTACTACGAGCG
CGACCCCAAGCGCATTTATTATCTTTCCCTGGAATTCTACATGGGTCGCACGCTGCAGAA
CACGATGGTGAACCTGGGCCTTCAGAATGCCTGCGATGAAGCCATCTATCAGTTGGGGTT
AGACTTGGAGGAACTCGAGGAGATAGAAGAAGATGCTGGCCTTGGGAATGGAGGCCTGGG
GAGGCTGGCAGCGTGTTTCCTTGACTCAATGGCTACCTTGGGCCTGGCAGCATACGGCTA
TGGAATCCGCTATGAATTTGGGATTTTTAACCAGAAGATTGTCAATGGCTGGCAGGTAGA
GGAGGCCGATGACTGGCTGCGCTACGGCAACCCCTGGGAGAAAGCGCGGCCTGAGTATAT
GCTTCCCGTGCACTTCTACGGACGCGTGGAGCACACCCCCGACGGCGTGAAGTGGCTGGA
CACACAGGTGGTGCTGGCCATGCCCTACGACACCCCAGTGCCCGGCTACAAGAACAACAC
CGTCAACACCATGCGGCTGTGGTCCGCCAAGGCTCCCAACGACTTCAAGCTGCAGGACTT
CAACGTGGGAGACTACATCGAGGCGGTCCTGGACCGGAACTTGGCTGAGAACATCTCCAG
GGTCCTGTATCCAAATGATAACTTCTTTGAGGGGAAGGAGCTGCGGCTGAAGCAGGAGTA
CTTCGTGGTGGCCTCCACGCTCCAGGACATCATCCGCCGCTTCAAGTCGTCCAAGTTCGG
CTGCCGGGACCCTGTGAGAACCTGTTTCGAGACGTTCCCAGACAAGGTGGCCATCCAGCT
GAACGACACCCACCCCGCCCTCTCCATCCCTGAGCTCATGCGGATCCTGGTGGACGTGGA
GAAGGTGGACTGGGACAAGGCCTGGGAAATCACGAAGAAGACCTGTGCGTACACCAACCA
CACTGTGCTGCCTGAGGCCTTGGAGCGCTGGCCCGTGTCCATGTTTGAGAAGCTGCTGCC
GCGGCACCTGGAGATAATCTATGCCATCAACCAGCGGCACCTGGACCACGTGGCCGCGCT
GTTTCCCGGCGATGTGGACCGCCTGCGCAGGATGTCTGTGATCGAGGAGGGGGACTGCAA
GCGGATCAACATGGCCCACCTGTGTGTGATTGGGTCCCATGCTGTCAATGGTGTGGCGAG
GATCCACTCGGAGATCGTGAAACAGTCGGTCTTTAAGGATTTTTATGAACTGGAGCCAGA
GAAGTTCCAGAATAAGACCAATGGCATCACCCCCCGCCGGTGGCTGCTGCTGTGCAACCC
GGGGCTGGCCAATACCATCGTGGAGAAAATTGGGGAGGAGTTCCTGACTGACCTGAGCCA
GCTGAAGAAGCTGCTGCCGCTGGTCAGTGACGAGGTGTTCATCAGGGACGTGGCCAAGGT
CAAACAGGAGAACAAGCTCAAGTTCTCGGCCTTCCTGGAGAAGGAGTACAAGGTGAAGAT
CAACCCCTCCTCCATGTTCGACGTGCATGTGAAGAGGATCCACGAGTACAAGCGGCAGCT
GCTCAACTGCCTGCACGTCGTCACCCTGTACAATCGAATCAAGAGAGACCCGGCCAAGGC
TTTTGTGCCCAGGACTGTTATGATTGGGGGCAAGGCAGCGCCCGGTTACCACATGGCCAA
GCTGATCATCAAGTTGGTCACCTCCATCGGCGACGTCGTCAATCATGACCCAGTTGTGGG
TGACAGGTTGAAAGTGATCTTCCTGGAGAACTACCGTGTGTCCTTGGCTGAGAAAGTGAT
CCCGGCCGCTGATCTGTCGCAGCAGATCTCCACTGCAGGCACCGAGGCCTCAGGCACAGG
CAACATGAAGTTCATGCTCAACGGGGCCCTCACCATCGGCACCATGGACGGCGCCAACGT
GGAGATGGCCGAGGAGGCCGGGGCCGAGAACCTCTTCATCTTCGGCCTGCGGGTGGAGGA
TGTCGAGGCCTTGGACCGGAAAGGGTACAATGCCAGGGAGTACTACGACCACCTGCCCGA
GCTGAAGCAGGCCGTGGACCAGATCAGCAGTGGCTTTTTTTCTCCCAAGGAGCCAGACTG
CTTCAAGGACATCGTGAACATGCTGATGCACCATGACAGGTTCAAGGTGTTTGCAGACTA
TGAAGCCTACATGCAGTGCCAGGCACAGGTGGACCAACTGTACCGGAACCCCAAGGAGTG
GACCAAGAAGGTCATCAGGAACATCGCCTGCTCGGGCAAGTTCTCCAGTGACCGGACCAT
CACGGAGTATGCACGGGAGATCTGGGGTGTGGAGCCCTCCGACCTGCAGATCCCGCCCCC
CAACATCCCCCGGGACTAG
GenBank Gene IDAB209080
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDNot Available
Chromosome LocationNot Available
LocusNot Available
ReferencesNot Available