| Name | 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ |
|---|
| Synonyms | - (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
- 4.2.1.59
- Beta-hydroxyacyl-ACP dehydratase
|
|---|
| Gene Name | fabZ |
|---|
| Organism | Helicobacter pylori |
|---|
| Amino acid sequence | >lcl|BSEQ0022083|3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
MEQSHQNLQSQFFIEHILQILPHRYPMLLVDRITELQANQKIVAYKNITFNEDVFNGHFP
NKPIFPGVLIVEGMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE
YHLEVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAERE |
|---|
| Number of residues | 159 |
|---|
| Molecular Weight | 18184.08 |
|---|
| Theoretical pI | 6.81 |
|---|
| GO Classification | Functions - 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
Processes - fatty acid biosynthetic process
- lipid A biosynthetic process
Components |
|---|
| General Function | 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity |
|---|
| Specific Function | Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs.Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs (By similarity). |
|---|
| Pfam Domain Function | |
|---|
| Transmembrane Regions | Not Available |
|---|
| GenBank Protein ID | 56684725 |
|---|
| UniProtKB ID | Q5G940 |
|---|
| UniProtKB Entry Name | Q5G940_HELPX |
|---|
| Cellular Location | Cytoplasm |
|---|
| Gene sequence | Not Available |
|---|
| GenBank Gene ID | AY725427 |
|---|
| GeneCard ID | Not Available |
|---|
| GenAtlas ID | Not Available |
|---|
| HGNC ID | Not Available |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | Not Available |
|---|
| References | - Liu W, Luo C, Han C, Peng S, Yang Y, Yue J, Shen X, Jiang H: A new beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) from Helicobacter pylori: Molecular cloning, enzymatic characterization, and structural modeling. Biochem Biophys Res Commun. 2005 Aug 12;333(4):1078-86. 15967411
- Kong YH, Zhang L, Yang ZY, Han C, Hu LH, Jiang HL, Shen X: Natural product juglone targets three key enzymes from Helicobacter pylori: inhibition assay with crystal structure characterization. Acta Pharmacol Sin. 2008 Jul;29(7):870-6. doi: 10.1111/j.1745-7254.2008.00808.x. 18565285
- Zhang L, Kong Y, Wu D, Zhang H, Wu J, Chen J, Ding J, Hu L, Jiang H, Shen X: Three flavonoids targeting the beta-hydroxyacyl-acyl carrier protein dehydratase from Helicobacter pylori: crystal structure characterization with enzymatic inhibition assay. Protein Sci. 2008 Nov;17(11):1971-8. doi: 10.1110/ps.036186.108. Epub 2008 Sep 9. 18780820
- Chen J, Zhang L, Zhang Y, Zhang H, Du J, Ding J, Guo Y, Jiang H, Shen X: Emodin targets the beta-hydroxyacyl-acyl carrier protein dehydratase from Helicobacter pylori: enzymatic inhibition assay with crystal structural and thermodynamic characterization. BMC Microbiol. 2009 May 12;9:91. doi: 10.1186/1471-2180-9-91. 19433000
- He L, Zhang L, Liu X, Li X, Zheng M, Li H, Yu K, Chen K, Shen X, Jiang H, Liu H: Discovering potent inhibitors against the beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) of Helicobacter pylori: structure-based design, synthesis, bioassay, and crystal structure determination. J Med Chem. 2009 Apr 23;52(8):2465-81. doi: 10.1021/jm8015602. 19309082
|
|---|
