You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameLengsin
Synonyms
  • GLULD1
  • Glutamate-ammonia ligase domain-containing protein 1
  • Lens glutamine synthase-like
  • LGS
Gene NameLGSN
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004462|Lengsin
MNNEEDLLQEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMRDS
SQILTPPQLSSRMKHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFFQEKVSHGVCMP
RGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPL
LTSPRYIAKRQLSHLQASGFSLLSAFIYDFCIFGVPEILNSKIISFPALTFLNNHDQPFM
QELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIA
SFFIETGFCDSGILSHSLWDVDRKKNMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMA
PSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVL
AATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETF
IRYFVAMKKYELENEEIAAERNKFLEYFI
Number of residues509
Molecular Weight57277.46
Theoretical pI6.3
GO Classification
Functions
  • glutamate-ammonia ligase activity
Processes
  • glutamine biosynthetic process
Components
  • plasma membrane
General FunctionGlutamate-ammonia ligase activity
Specific FunctionMay act as a component of the cytoskeleton or as a chaperone for the reorganization of intermediate filament proteins during terminal differentiation in the lens. Does not seem to have enzymatic activity (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein ID7341339
UniProtKB IDQ5TDP6
UniProtKB Entry NameLGSN_HUMAN
Cellular LocationNot Available
Gene sequence
>lcl|BSEQ0016738|Lengsin (LGSN)
ATGAATAATGAAGAGGACCTTCTGCAGGAGGACTCAACAAGAGATGAAGGCAATGAGACT
GAAGCCAACAGCATGAACACATTAAGAAGGACAAGGAAGAAAGTCACTAAACCATATGTT
TGTTCAACTGAAGTGGGAGAAACGGATATGTCCAATTCAAATGATTGCATGAGGGACAGC
AGTCAAATTTTGACCCCACCTCAACTCTCTTCTAGAATGAAACACATTAGACAAGCCATG
GCCAAAAATCGCCTCCAGTTTGTACGATTTGAAGCAACAGACCTCCACGGCGTGTCCAGG
TCTAAGACTATCCCTGCACACTTTTTTCAAGAGAAAGTGAGCCATGGTGTTTGCATGCCC
CGAGGTTATCTTGAAGTGATACCAAATCCAAAGGACAATGAAATGAATAACATAAGAGCC
ACATGTTTTAATAGCGACATAGTCCTAATGCCAGAGTTATCAACCTTTAGAGTTTTGCCA
TGGGCTGACAGAACTGCAAGAGTGATATGTGATACCTTCACTGTGACTGTCTCTGGGATG
TCGATAGGAAGAAAAACATGTTCTGCAGCACTTCTGGAACTGAGCAGCTCACGATCACTG
GGAAAAAATGGTTGGCAGGACTCTTGA
GenBank Gene IDAF242388
GeneCard IDNot Available
GenAtlas IDGLULD1
HGNC IDHGNC:21016
Chromosome Location6
Locus6pter-q22.33
References
  1. Grassi F, Moretto N, Rivetti C, Cellai S, Betti M, Marquez AJ, Maraini G, Ottonello S: Structural and functional properties of lengsin, a pseudo-glutamine synthetase in the transparent human lens. Biochem Biophys Res Commun. 2006 Nov 17;350(2):424-9. Epub 2006 Sep 25. 17010935
  2. Wistow G, Bernstein SL, Wyatt MK, Behal A, Touchman JW, Bouffard G, Smith D, Peterson K: Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants. Mol Vis. 2002 Jun 15;8:171-84. 12107413
  3. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. 14574404
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334