Cytochrome c oxidase subunit 8C, mitochondrial

NameCytochrome c oxidase subunit 8C, mitochondrial
Synonyms
  • COX VIII-3
  • Cytochrome c oxidase polypeptide 8 isoform 3
  • Cytochrome c oxidase polypeptide VIII isoform 3
  • Cytochrome c oxidase subunit 8-3
Gene NameCOX8C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013415|Cytochrome c oxidase subunit 8C, mitochondrial
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA
YVLGNLKQFRRN
Number of residues72
Molecular Weight8128.575
Theoretical pINot Available
GO Classification
Functions
  • cytochrome-c oxidase activity
Processes
  • hydrogen ion transmembrane transport
  • mitochondrial electron transport, cytochrome c to oxygen
Components
  • mitochondrion
  • integral component of membrane
  • mitochondrial respiratory chain complex IV
General FunctionCytochrome-c oxidase activity
Specific FunctionThis protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Pfam Domain Function
Transmembrane Regions41-64
GenBank Protein IDNot Available
UniProtKB IDQ7Z4L0
UniProtKB Entry NameCOX8C_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0013416|Cytochrome c oxidase subunit 8C, mitochondrial (COX8C)
ATGCCTCTCCTGCGTGGGCGCTGTCCTGCCCGCCGCCACTACCGCCGCTTGGCCCTGCTC
GGCCTGCAGCCCGCTCCCCGCTTCGCCCACTCGGGGCCCCCGCGCCAGCGGCCCCTGTCT
GCCGCGGAAATGGCTGTTGGACTTGTGGTGTTTTTTACGACCTTCTTAACACCAGCTGCA
TATGTGCTAGGCAACCTGAAGCAGTTCAGAAGGAATTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:24382
Chromosome Location14
LocusNot Available
References
  1. Huttemann M, Schmidt TR, Grossman LI: A third isoform of cytochrome c oxidase subunit VIII is present in mammals. Gene. 2003 Jul 17;312:95-102. 12909344
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334