Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameThioredoxin reductase 3
Synonyms
  • 1.8.1.9
  • TGR
  • Thioredoxin and glutathione reductase
  • Thioredoxin reductase TR2
  • TRXR3
Gene NameTXNRD3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008760|Thioredoxin reductase 3
MERSPPQSPGPGKAGDAPNRRSGHVRGARVLSPPGRRARLSSPGPSRSSEAREELRRHLV
GLIERSRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTV
PNIFVNKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGK
KVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRH
NWETMTKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ
FVIATGERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDV
TVMVRSILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEG
TETIEGVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDIL
EDKPELTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKK
ENLEIYHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAM
KCGLTKQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG
Number of residues643
Molecular Weight70682.52
Theoretical pINot Available
GO Classification
Functions
  • thioredoxin-disulfide reductase activity
  • protein disulfide oxidoreductase activity
  • electron carrier activity
  • flavin adenine dinucleotide binding
Processes
  • cell redox homeostasis
  • cell differentiation
  • multicellular organismal development
  • spermatogenesis
Components
  • endoplasmic reticulum
  • nucleus
General FunctionThioredoxin-disulfide reductase activity
Specific FunctionDisplays thioredoxin reductase, glutaredoxin and glutathione reductase activities. Catalyzes disulfide bond isomerization. Promotes disulfide bond formation between GPX4 and various sperm proteins and may play a role in sperm maturation by promoting formation of sperm structural components (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ86VQ6
UniProtKB Entry NameTRXR3_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0020811|Thioredoxin reductase 3 (TXNRD3)
CTGGAGCGGTCGCCGCCGCAGTCGCCCGGGCCGGGAAAGGCGGGCGATGCCCCCAACCGC
CGCTCGGGCCATGTCCGAGGGGCGCGCGTGTTGTCGCCGCCGGGGCGCCGTGCCCGCCTG
TCGTCCCCCGGGCCCAGCCGCTCGTCCGAGGCCCGCGAGGAGCTGCGCCGCCACCTCGTG
GGCCTCATCGAGCGCAGCCGGGTGGTGATCTTCAGCAAGAGCTACTGTCCCCATAGTACT
CGGGTGAAAGAACTCTTTTCTTCTTTGGGAGTCGAATGTAATGTCTTGGAACTTGATCAA
GTTGATGATGGGGCCAGGGTTCAAGAAGTGCTGTCAGAAATCACTAATCAGAAAACTGTG
CCCAATATTTTCGTGAATAAAGTGCATGTAGGTGGATGTGACCAAACTTTCCAGGCATAT
CAGAGTGGTTTGTTACAGAAGCTCCTTCAGGAAGATTTGGCATATGATTATGATCTCATC
ATCATCGGTGGTGGTTCTGGAGGCCTTTCATGTGCGAAGGAAGCTGCCATTTTGGGAAAG
AAAGTTATGGTGCTAGACTTTGTTGTCCCGTCACCTCAGGGCACATCCTGGGGTCTTGGT
GGCACTTGTGTAAATGTAGGTTGTATTCCTAAGAAATTGATGCATCAGGCTGCCCTTTTG
GGGCAGGCATTATGTGACTCAAGGAAATTTGGCTGGGAATATAATCAACAAGTGAGGCAC
AACTGGGAGACAATGACAAAAGCGATTCAGAACCACATCAGCTCTCTAAACTGGGGCTAC
AGGTTGTCTCTGAGGGAAAAGGCTGTGGCCTATGTCAATTCCTATGGAGAATTTGTTGAA
CATCATAAAATAAAGGCAACCAATAAAAAAGGACAGGAGACTTATTATACTGCTGCACAG
TTTGTCATAGCAACGGGTGAAAGGCCACGGTATTTAGGAATCCAAGGAGATAAAGAATAC
TGTATTACTAGTGATGACCTTTTTTCTCTGCCTTATTGCCCTGGCAAAACATTAGTGGTG
GGTGCCTCTTATGTTGCCCTGGAGTGTGCAGGGTTTCTGGCTGGCTTTGGCCTAGATGTC
ACAGTTATGGTACGCTCAATCCTTCTCCGTGGCTTCGACCAAGAAATGGCAGAAAAAGTG
GGTTCCTACATGGAGCAGCATGGTGTGAAGTTCCTACGGAAATTCATACCTGTGATGGTT
CAACAGTTGGAGAAAGGTTCACCTGGAAAGCTGAAAGTGTTGGCTAAATCCACTGAAGGA
ACAGAAACAATTGAAGGAGTCTATAACACAGTTTTGTTAGCTATTGGTCGTGACTCCTGT
ACAAGGAAAATAGGCTTGGAGAAGATTGGTGTCAAAATTAATGAGAAGAGTGGAAAAATA
CCTGTAAATGATGTGGAACAGACCAATGTGCCATATGTCTATGCTGTTGGTGATATTTTG
GAGGATAAGCCAGAGCTCACTCCTGTCGCCATACAGTCAGGCAAGCTGCTAGCTCAGAGA
CTTTTTGGGGCCTCTTTAGAAAAGATATATCATACTTTGTTCTGGCCTCTTGAATGGACA
GTAGCTGGCAGAGAGAACAACACTTGTTACGCAAAGATAATCTGCAATAAATTCGACCAT
GATCGGGTGATAGGATTTCATATTCTTGGACCAAACGCCGGTGAGGTTACCCAAGGATTT
GCAGCTGCAATGAAATGTGGGCTCACAAAACAGCTACTTGATGACACCATTGGAATTCAC
CCCACATGTGGGGAGGTGTTCACGACTTTGGAAATCACAAAGTCGTCAGGACTAGACATC
ACTCAGAAAGGCTGCTGAGGCTAG
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:20667
Chromosome Location3
LocusNot Available
References
  1. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. 16641997
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Sun QA, Wu Y, Zappacosta F, Jeang KT, Lee BJ, Hatfield DL, Gladyshev VN: Redox regulation of cell signaling by selenocysteine in mammalian thioredoxin reductases. J Biol Chem. 1999 Aug 27;274(35):24522-30. 10455115
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  5. Gerashchenko MV, Su D, Gladyshev VN: CUG start codon generates thioredoxin/glutathione reductase isoforms in mouse testes. J Biol Chem. 2010 Feb 12;285(7):4595-602. doi: 10.1074/jbc.M109.070532. Epub 2009 Dec 14. 20018845