You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameTransient receptor potential cation channel subfamily V member 3
Synonyms
  • TrpV3
  • Vanilloid receptor-like 3
  • VRL-3
Gene NameTRPV3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006666|Transient receptor potential cation channel subfamily V member 3
MKAHPKEMVPLMGKRVAAPSGNPAILPEKRPAEITPTKKSAHFFLEIEGFEPNPTVAKTS
PPVFSKPMDSNIRQCISGNCDDMDSPQSPQDDVTETPSNPNSPSAQLAKEEQRRKKRRLK
KRIFAAVSEGCVEELVELLVELQELCRRRHDEDVPDFLMHKLTASDTGKTCLMKALLNIN
PNTKEIVRILLAFAEENDILGRFINAEYTEEAYEGQTALNIAIERRQGDIAALLIAAGAD
VNAHAKGAFFNPKYQHEGFYFGETPLALAACTNQPEIVQLLMEHEQTDITSRDSRGNNIL
HALVTVAEDFKTQNDFVKRMYDMILLRSGNWELETTRNNDGLTPLQLAAKMGKAEILKYI
LSREIKEKRLRSLSRKFTDWAYGPVSSSLYDLTNVDTTTDNSVLEITVYNTNIDNRHEML
TLEPLHTLLHMKWKKFAKHMFFLSFCFYFFYNITLTLVSYYRPREEEAIPHPLALTHKMG
WLQLLGRMFVLIWAMCISVKEGIAIFLLRPSDLQSILSDAWFHFVFFIQAVLVILSVFLY
LFAYKEYLACLVLAMALGWANMLYYTRGFQSMGMYSVMIQKVILHDVLKFLFVYIVFLLG
FGVALASLIEKCPKDNKDCSSYGSFSDAVLELFKLTIGLGDLNIQQNSKYPILFLFLLIT
YVILTFVLLLNMLIALMGETVENVSKESERIWRLQRARTILEFEKMLPEWLRSRFRMGEL
CKVAEDDFRLCLRINEVKWTEWKTHVSFLNEDPGPVRRTDFNKIQDSSRNNSKTTLNAFE
EVEEFPETSV
Number of residues790
Molecular Weight90635.115
Theoretical pI6.56
GO Classification
Functions
  • calcium channel activity
Processes
  • transmembrane transport
  • ion transmembrane transport
  • calcium ion transmembrane transport
  • positive regulation of calcium ion import
  • response to heat
  • negative regulation of hair cycle
Components
  • plasma membrane
  • receptor complex
  • integral component of membrane
General FunctionCalcium channel activity
Specific FunctionPutative receptor-activated non-selective calcium permeant cation channel. It is activated by innocuous (warm) temperatures and shows an increased response at noxious temperatures greater than 39 degrees Celsius. Activation exhibits an outward rectification. May associate with TRPV1 and may modulate its activity. Is a negative regulator of hair growth and cycling: TRPV3-coupled signaling suppresses keratinocyte proliferation in hair follicles and induces apoptosis and premature hair follicle regression (catagen).
Pfam Domain Function
Transmembrane Regions440-460 488-508 524-544 546-566 590-610 650-670
GenBank Protein IDNot Available
UniProtKB IDQ8NET8
UniProtKB Entry NameTRPV3_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0006665|2373 bp
ATGAAAGCCCACCCCAAGGAGATGGTGCCTCTCATGGGCAAGAGAGTTGCTGCCCCCAGT
GGGAACCCTGCCGTCCTGCCAGAGAAGAGGCCGGCGGAGATCACCCCCACAAAGAAGAGT
GCACACTTCTTCCTGGAGATAGAAGGGTTTGAACCCAACCCCACAGTTGCCAAGACCTCT
CCTCCTGTCTTCTCCAAGCCCATGGATTCCAACATCCGGCAGTGCATCTCTGGTAACTGT
GATGACATGGACTCCCCCCAGTCTCCTCAGGATGATGTGACAGAGACCCCATCCAATCCC
AACAGCCCCAGTGCACAGCTGGCCAAGGAAGAGCAGAGGAGGAAAAAGGGGCGGCTGAAG
AAGCGCATCTTTGCAGCCGTGTCTGAGGGCTGCGTGGAGGAGTTGGTAGAGTTGCTGGTG
GAGCTGCAGGAGCTTTGCAGGCGGCGCCATGATGAGGATGTGCCTGACTTCCTCATGCAC
AAGCTGACGGCCTCCGACACGGGGAAGACCTGCCTGATGAAGGCCTTGTTAAACATCAAC
CCCAACACCAAGGAGATAGTGCGGATCCTGCTTGCCTTTGCTGAAGAGAACGACATCCTG
GGCAGGTTCATCAACGCCGAGTACACAGAGGAGGCCTATGAAGGGCAGACGGCGCTGAAC
ATCGCCATCGAGCGGCGGCAGGGGGACATCGCAGCCCTGCTCATCGCCGCCGGCGCCGAC
GTCAACGCGCACGCCAAGGGGGCCTTCTTCAACCCCAAGTACCAACACGAAGGCTTCTAC
TTCGGTGAGACGCCCCTGGCCCTGGCAGCATGCACCAACCAGCCCGAGATTGTGCAGCTG
CTGATGGAGCACGAGCAGACGGACATCACCTCGCGGGACTCACGAGGCAACAACATCCTT
CACGCCCTGGTGACCGTGGCCGAGGACTTCAAGACACAGAATGACTTTGTGAAGCGCATG
TACGACATGATCCTACTGCGGAGTGGCAACTGGGAGCTGGAGACCACTCGCAACAACGAT
GGCCTCACGCCGCTGCAGCTGGCCGCCAAGATGGGCAAGGCGGAGATCCTGAAGTACATC
CTCAGTCGTGAGATCAAGGAGAAGCGGCTCCGGAGCCTGTCCAGGAAGTTCACCGACTGG
GCGTACGGACCCGTGTCATCCTCCCTCTACGACCTCACCAACGTGGACACCACCACGGAC
AACTCAGTGCTGGAAATCACTGTCTACAACACCAACATCGACAACCGGCATGAGATGCTG
ACCCTGGAGCCGCTGCACACGCTGCTGCATATGAAGTGGAAGAAGTTTGCCAAGCACATG
TTCTTTCTGTCCTTCTGCTTTTATTTCTTCTACAACATCACCCTGACCCTCGTCTCGTAC
TACCGCCCCCGGGAGGAGGAGGCCATCCCGCACCCCTTGGCCCTGACGCACAAGATGGGG
TGGCTGCAGCTCCTAGGGAGGATGTTTGTGCTCATCTGGGCCATGTGCATCTCTGTGAAA
GAGGGCATTGCCATCTTCCTGCTGAGACCCTCGGATCTGCAGTCCATCCTCTCGGATGCC
TGGTTCCACTTTGTCTTTTTTATCCAAGCTGTGCTTGTGATACTGTCTGTCTTCTTGTAC
TTGTTTGCCTACAAAGAGTACCTCGCCTGCCTCGTGCTGGCCATGGCCCTGGGCTGGGCG
AACATGCTCTACTATACGCGGGGTTTCCAGTCCATGGGCATGTACAGCGTCATGATCCAG
AAGGTTATTTTGCATGATGTTCTGAAGTTCTTGTTTGTATATATCGTGTTTTTGCTTGGA
TTTGGAGTAGCCTTGGCCTCGCTGATCGAGAAGTGTCCCAAAGACAACAAGGACTGCAGC
TCCTACGGCAGCTTCAGCGACGCAGTGCTGGAACTCTTCAAGCTCACCATAGGCCTGGGT
GATCTGAACATCCAGCAGAACTCCAAGTATCCCATTCTCTTTCTGTTCCTGCTCATCACC
TATGTCATCCTCACCTTTGTTCTCCTCCTCAACATGCTCATTGCTCTGATGGGCGAGACT
GTGGAGAACGTCTCCAAGGAGAGCGAACGCATCTGGCGCCTGCAGAGAGCCAGGACCATC
TTGGAGTTTGAGAAAATGTTACCAGAATGGCTGAGGAGCAGATTCCGGATGGGAGAGCTG
TGCAAAGTGGCCGAGGATGATTTCCGACTGTGTTTGCGGATCAATGAGGTGAAGTGGACT
GAATGGAAGACGCACGTCTCCTTCCTTAACGAAGACCCGGGGCCTGTAAGACGAACAGAT
TTCAACAAAATCCAAGATTCTTCCAGGAACAACAGCAAAACCACTCTCAATGCATTTGAA
GAAGTCGAGGAATTCCCGGAAACCTCGGTGTAG
GenBank Gene IDAJ487035
GeneCard IDNot Available
GenAtlas IDTRPV3
HGNC IDHGNC:18084
Chromosome LocationNot Available
Locus17p13.3
References
  1. Smith GD, Gunthorpe MJ, Kelsell RE, Hayes PD, Reilly P, Facer P, Wright JE, Jerman JC, Walhin JP, Ooi L, Egerton J, Charles KJ, Smart D, Randall AD, Anand P, Davis JB: TRPV3 is a temperature-sensitive vanilloid receptor-like protein. Nature. 2002 Jul 11;418(6894):186-90. Epub 2002 Jun 23. 12077606
  2. Xu H, Ramsey IS, Kotecha SA, Moran MM, Chong JA, Lawson D, Ge P, Lilly J, Silos-Santiago I, Xie Y, DiStefano PS, Curtis R, Clapham DE: TRPV3 is a calcium-permeable temperature-sensitive cation channel. Nature. 2002 Jul 11;418(6894):181-6. Epub 2002 Jun 23. 12077604
  3. Borbiro I, Lisztes E, Toth BI, Czifra G, Olah A, Szollosi AG, Szentandrassy N, Nanasi PP, Peter Z, Paus R, Kovacs L, Biro T: Activation of transient receptor potential vanilloid-3 inhibits human hair growth. J Invest Dermatol. 2011 Aug;131(8):1605-14. doi: 10.1038/jid.2011.122. Epub 2011 May 19. 21593771
  4. He Y, Zeng K, Zhang X, Chen Q, Wu J, Li H, Zhou Y, Glusman G, Roach J, Etheridge A, Qing S, Tian Q, Lee I, Tian X, Wang X, Wu Z, Hood L, Ding Y, Wang K: A gain-of-function mutation in TRPV3 causes focal palmoplantar keratoderma in a Chinese family. J Invest Dermatol. 2015 Mar;135(3):907-9. doi: 10.1038/jid.2014.429. Epub 2014 Oct 6. 25285920
  5. Lin Z, Chen Q, Lee M, Cao X, Zhang J, Ma D, Chen L, Hu X, Wang H, Wang X, Zhang P, Liu X, Guan L, Tang Y, Yang H, Tu P, Bu D, Zhu X, Wang K, Li R, Yang Y: Exome sequencing reveals mutations in TRPV3 as a cause of Olmsted syndrome. Am J Hum Genet. 2012 Mar 9;90(3):558-64. doi: 10.1016/j.ajhg.2012.02.006. 22405088
  6. Lai-Cheong JE, Sethuraman G, Ramam M, Stone K, Simpson MA, McGrath JA: Recurrent heterozygous missense mutation, p.Gly573Ser, in the TRPV3 gene in an Indian boy with sporadic Olmsted syndrome. Br J Dermatol. 2012 Aug;167(2):440-2. doi: 10.1111/j.1365-2133.2012.11115.x. 22835024