Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSolute carrier family 22 member 8
Synonyms
  • hOAT3
  • OAT3
  • Organic anion transporter 3
Gene NameSLC22A8
OrganismHuman
Amino acid sequence
>lcl|BSEQ0007005|Solute carrier family 22 member 8
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS
Number of residues542
Molecular Weight59855.585
Theoretical pI9.05
GO Classification
Functions
  • inorganic anion exchanger activity
  • sodium-independent organic anion transmembrane transporter activity
Processes
  • anion transmembrane transport
  • transmembrane transport
  • response to toxic substance
  • sodium-independent organic anion transport
Components
  • plasma membrane
  • extracellular exosome
  • integral component of plasma membrane
  • basolateral plasma membrane
General FunctionSodium-independent organic anion transmembrane transporter activity
Specific FunctionPlays an important role in the excretion/detoxification of endogenous and exogenous organic anions, especially from the brain and kidney. Involved in the transport basolateral of steviol, fexofenadine. Transports benzylpenicillin (PCG), estrone-3-sulfate (E1S), cimetidine (CMD), 2,4-dichloro-phenoxyacetate (2,4-D), p-amino-hippurate (PAH), acyclovir (ACV) and ochratoxin (OTA).
Pfam Domain Function
Transmembrane Regions10-30 124-144 155-175 177-197 213-233 237-257 328-348 355-375 387-407 412-432 472-492
GenBank Protein ID4378059
UniProtKB IDQ8TCC7
UniProtKB Entry NameS22A8_HUMAN
Cellular LocationBasolateral cell membrane
Gene sequence
>lcl|BSEQ0019450|Solute carrier family 22 member 8 (SLC22A8)
ATGACCTTCTCGGAGATCCTGGACCGTGTGGGAAGCATGGGCCATTTCCAGTTCCTGCAT
GTAGCCATACTGGGCCTCCCGATCCTCAACATGGCCAACCACAACCTGCTGCAGATCTTC
ACAGCCGCCACCCCTGTCCACCACTGTCGCCCGCCCCACAATGCCTCCACAGGGCCTTGG
GTGCTCCCCATGGGCCCAAATGGGAAGCCTGAGAGGTGCCTCCGTTTTGTACATCCGCCC
AATGCCAGCCTGCCCAATGACACCCAGAGGGCCATGGAGCCATGCCTGGATGGCTGGGTC
TACAACAGCACCAAGGACTCCATTGTGACAGAGTGGGACTTGGTGTGCAACTCCAACAAA
CTGAAGGAGATGGCCCAGTCTATCTTCATGGCAGGTATACTGATTGGAGGGCTCGTGCTT
GGAGACCTGTCTGACAGGTTTGGCCGCAGGCCCATCCTGACCTGCAGCTACCTGCTGCTG
GCAGCCAGCGGCTCCGGTGCAGCCTTCAGCCCCACCTTCCCCATCTACATGGTCTTCCGC
TTCCTGTGTGGCTTTGGCATCTCAGGCATTACCCTGAGCACCGTCATCTTGAATGTGGAA
TGGGTGCCTACCCGGATGCGGGCCATCATGTCGACAGCACTCGGGTACTGCTACACCTTT
GGCCAGTTCATTCTGCCCGGCCTGGCCTACGCCATCCCCCAGTGGCGTTGGCTGCAGTTA
ACTGTGTCCATTCCCTTCTTCGTCTTCTTCCTATCATCCTGGTGGACACCAGAGTCCATA
CGCTGGTTGGTCTTGTCTGGAAAGTCCTCGAAGGCCCTGAAGATACTCCGGCGGGTGGCT
GTCTTCAATGGCAAGAAGGAAGAGGGAGAAAGGCTCAGCTTGGAGGAGCTCAAACTCAAC
CTGCAGAAGGAGATCTCCTTGGCCAAGGCCAAGTACACCGCAAGTGACCTGTTCCGGATA
CCCATGCTGCGCCGCATGACCTTCTGTCTTTCCCTGGCCTGGTTTGCTACCGGTTTTGCC
TACTATAGTTTGGCTATGGGTGTGGAAGAATTTGGAGTCAACCTCTACATCCTCCAGATC
ATCTTTGGTGGGGTCGATGTCCCAGCCAAGTTCATCACCATCCTCTCCTTAAGCTACCTG
GGCCGGCATACCACTCAGGCCGCTGCCCTGCTCCTGGCAGGAGGGGCCATCTTGGCTCTC
ACCTTTGTGCCCTTGGACTTGCAGACCGTGAGGACAGTATTGGCTGTGTTTGGGAAGGGA
TGCCTATCCAGCTCCTTCAGCTGCCTCTTCCTCTACACAAGTGAATTATACCCCACAGTC
ATCAGGCAAACAGGTATGGGCGTAAGTAACCTGTGGACCCGCGTGGGAAGCATGGTGTCC
CCGCTGGTGAAAATCACGGGTGAGGTACAGCCCTTCATCCCCAATATCATCTACGGGATC
ACCGCCCTCCTCGGGGGCAGTGCTGCCCTCTTCCTGCCTGAGACCCTGAATCAGCCCTTG
CCAGAGACTATCGAAGACCTGGAAAACTGGTCCCTGCGGGCAAAGAAGCCAAAGCAGGAG
CCAGAGGTGGAAAAGGCCTCCCAGAGGATCCCTCTACAGCCTCACGGACCAGGCCTGGGC
TCCAGCTGA
GenBank Gene IDAF097491
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:10972
Chromosome Location11
Locus11q11
References
  1. Race JE, Grassl SM, Williams WJ, Holtzman EJ: Molecular cloning and characterization of two novel human renal organic anion transporters (hOAT1 and hOAT3). Biochem Biophys Res Commun. 1999 Feb 16;255(2):508-14. 10049739
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. 16554811
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Motohashi H, Sakurai Y, Saito H, Masuda S, Urakami Y, Goto M, Fukatsu A, Ogawa O, Inui K: Gene expression levels and immunolocalization of organic ion transporters in the human kidney. J Am Soc Nephrol. 2002 Apr;13(4):866-74. 11912245
  6. Bakhiya A, Bahn A, Burckhardt G, Wolff N: Human organic anion transporter 3 (hOAT3) can operate as an exchanger and mediate secretory urate flux. Cell Physiol Biochem. 2003;13(5):249-56. 14586168
  7. Srimaroeng C, Chatsudthipong V, Aslamkhan AG, Pritchard JB: Transport of the natural sweetener stevioside and its aglycone steviol by human organic anion transporter (hOAT1; SLC22A6) and hOAT3 (SLC22A8). J Pharmacol Exp Ther. 2005 May;313(2):621-8. Epub 2005 Jan 11. 15644426
  8. Tahara H, Shono M, Kusuhara H, Kinoshita H, Fuse E, Takadate A, Otagiri M, Sugiyama Y: Molecular cloning and functional analyses of OAT1 and OAT3 from cynomolgus monkey kidney. Pharm Res. 2005 Apr;22(4):647-60. Epub 2005 Apr 7. 15846473
  9. Tahara H, Kusuhara H, Maeda K, Koepsell H, Fuse E, Sugiyama Y: Inhibition of oat3-mediated renal uptake as a mechanism for drug-drug interaction between fexofenadine and probenecid. Drug Metab Dispos. 2006 May;34(5):743-7. Epub 2006 Feb 2. 16455804
  10. Nishizato Y, Ieiri I, Suzuki H, Kimura M, Kawabata K, Hirota T, Takane H, Irie S, Kusuhara H, Urasaki Y, Urae A, Higuchi S, Otsubo K, Sugiyama Y: Polymorphisms of OATP-C (SLC21A6) and OAT3 (SLC22A8) genes: consequences for pravastatin pharmacokinetics. Clin Pharmacol Ther. 2003 Jun;73(6):554-65. 12811365
  11. Erdman AR, Mangravite LM, Urban TJ, Lagpacan LL, Castro RA, de la Cruz M, Chan W, Huang CC, Johns SJ, Kawamoto M, Stryke D, Taylor TR, Carlson EJ, Ferrin TE, Brett CM, Burchard EG, Giacomini KM: The human organic anion transporter 3 (OAT3; SLC22A8): genetic variation and functional genomics. Am J Physiol Renal Physiol. 2006 Apr;290(4):F905-12. Epub 2005 Nov 15. 16291576