You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameFas-binding factor 1
Synonyms
  • ALB
  • FBF-1
  • KIAA1863
  • Protein albatross
Gene NameFBF1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009834|Fas-binding factor 1
MAPKTKKGCKVTLPEKPVKLASHTRDTTGVSQMFPSSKARTKSLLGDDVFSTMAGLEEAD
AEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHPKPAGG
AIPTKKSLPSPSSSGHQNRRFSSEDLEDPLRGLLSYDEGGITKQPPVTQSKTASDKSPST
VRDQGPSIPLTPGDTPIRKKEELLFDDGDDIMATLGFGDSPKAEKRQIGDQEGPRPARST
LDELLGRGMATKLLARPGTGEHREFKLDKKYQRPQDSEDMWGDEDFTFGAYQPTVVSSEG
RQSRRQSVSRFFADSGADPKGEPGSKQSPPMASSPIQPRKGGADWLGLKDEDLDLFPASP
TREAHRESSVPVTPSVPPPASQHSTPAGLPPSRAKPPTEGAGSPAKASQASKLRASKEEK
EDWLSHALSRKKSQGLAREQHAGTSEGLHLAGTAGHPPSGSQPLTSTQGLEHAAAGGSSG
TTARERPCVRPGVSGSPVTQNHAASALPTGSPKRGTAPGDLSATEPATCFPSTQKPTEPS
VPVQPLLPESLARSLLPSTEYQKQLLAAQVQLQCSPAELQAELLHSQARLAELEAQVRKL
ELERAQHELLLGSLQQQHQADLELIESAHRSRIKVLETSYQQREERLRRENEELSARYLS
QCQEAEQARAELTAQHQRRLAAIAQEKDQEMERLRELQRASILDMRRDHEEQLQRLKLLK
DREVDAATSATSHTRSLNSIIHQMEKFSSSLHELSSRVEASHLTTSQERELGIRQRDEQL
RALQERLGQQQRDMEEERSRQQEVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRAL
EEQRKVTAQQMAMERAELERAKSALLEEQKSVMLKCGEERRRLAAEWAEFSAQQKLSKER
AEREAERALQVDTQREGTLISLAKQAELKIRASELRAEEKQLAAERAALEQERQELRLEK
ERINATALRVKLRAEEVESMSKVASEKYEEGERALREAQQVQAEQQARLQAVQQQQERLR
KQEQHMHQEHLSLAQQRLQLDRARQDLPSSLVGLFPRAQGPAASSQSALMPPAPTTRWCS
QPPTGLDPSPLHLHARLALLRHMAEQDRDFLENEQFFLETLKKGSYNLTSHSA
Number of residues1133
Molecular Weight125445.19
Theoretical pINot Available
GO Classification
Processes
  • cilium assembly
  • apical junction assembly
  • establishment of epithelial cell polarity
  • organelle organization
Components
  • spindle pole
  • centriole
  • ciliary transition fiber
  • cell junction
  • cytosol
  • centrosome
General FunctionNot Available
Specific FunctionKeratin-binding protein required for epithelial cell polarization. Involved in apical junction complex (AJC) assembly via its interaction with PARD3. Required for ciliogenesis.
Pfam Domain FunctionNot Available
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ8TES7
UniProtKB Entry NameFBF1_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013939|Fas-binding factor 1 (FBF1)
ATGGCACCAAAAACCAAGAAAGGATGTAAAGTGACACTACCTGAGAAGCCTGTTAAACTA
GCTTCACATACCAGAGACACCACAGGTGTATCTCAGATGTTCCCTTCTTCAAAGGCGAGA
ACAAAGTCCCTCCTGGGTGATGATGTCTTCAGCACCATGGCAGGCCTGGAAGAAGCTGAT
GCTGAGGTTTCAGGTATCTCAGAGGCAGACCCACAGGCTCTGCTCCAGGCCATGAAGGAC
CTGGACGGCATGGATGCTGATATCTTAGGTCTGAAGAAATCTAATTCAGCCCCTAGCAAA
AAAGCTGCAAAGGACCCTGGGAAAGGAGAGCTGCCCAACCACCCCAAGCCTGCAGGGGGT
GCCATTCCCACCAAGAAGTCACTTCCGTCTCCCAGCAGCTCTGGGCATCAGAACAGGAGG
TTTTCCTCTGAAGACTTGGAAGACCCATTGAGAGGACTTCTCTCCTATGATGAAGGAGGA
ATCACCAAGCAGCCGCCTGTGACACAGAGTAAAACAGCTTCTGACAAGAGCCCCAGCACA
GTGAGAGATCAAGGTCCCTCTATTCCTCTAACTCCTGGGGACACCCCCATCCGAAAAAAA
GAAGAATTGTTGTTTGATGATGGGGATGACATCATGGCCACCTTGGGGTTTGGAGACAGC
CCCAAAGCAGAGAAGAGGCAGATAGGAGACCAGGAAGGGCCTCGCCCTGCTCGCTCCACG
CTGGATGAGCTGCTGGGTCGAGGCATGGCCACCAAACTCCTGGCCCGCCCGGGCACCGGG
GAGCACAGGGAGTTCAAGCTAGACAAGAAGTACCAGAGGCCACAGGACAGTGAAGATATG
TGGGGTGACGAGGACTTCACCTTTGGAGCCTATCAGCCCACTGTGGTCTCCTCTGAGGGC
CGGCAGTCCCGCCGGCAGTCTGTCAGGTTCTTCGCAGACAGTGGCGCAGACCCCAAGGGA
GAACCAGGCTCCAAACAGAGCCCTCCAATGGCTTCCAGCCCCATCCAGCCCAGGAAGGGA
GGAGCTGACTGGTTGGGCCTCAAGGACGAGGACTTGGACCTGTTCCCTGCCTCACCCACC
AGAGAGGCCCATCGGGAAAGTTCAGTGCCTGTCACGCCCTCAGTGCCTCCTCCTGCGAGC
CAGCACTCCACGCCAGCTGGGCTGCCCCCCTCCAGGGCAAAGCCACCAACTGAAGGTGCA
GGGTCCCCTGCCAAAGCCAGCCAGGCTTCCAAGCTGCGAGCCTCCAAGGAGGAGAAAGAG
GACTGGCTGAGCCATGCCCTGTCTCGGAAGAAGTCCCAAGGCCTGGCCAGAGAGCAGCAT
GCTGGGACCTCTGAGGGCCTGCATTTGGCGGGGACAGCGGGCCATCCCCCTTCTGGCAGC
CAACCTCTCACCAGCACACAAGGGCTTGAGCACGCAGCTGCTGGAGGGAGTTCTGGAACA
ACTGCACGAGAAAGACCGTGTGTCAGGCCTGGTGTCTCGGGGTCCCCTGTGACTCAGAAC
CATGCCGCCTCAGCACTCCCTACAGGTTCCCCAAAGAGGGGAACAGCCCCTGGAGACCTC
TCAGCCACTGAGCCTGCCACGTGTTTCCCGAGCACCCAGAAACCCACAGAGCCTTCCGTG
CCCGTCCAGCCCCTGCTCCCAGAGTCCCTGGCCCGGAGCCTGCTGCCGAGCACAGAATAC
CAGAAGCAGCTCCTGGCAGCACAGGTGCAACTTCAGTGCAGCCCCGCTGAGCTCCAGGCC
GAGCTGCTGCATAGCCAGGCCCGGCTGGCAGAGCTGGAGGCCCAGGTGCGGAAGCTGGAG
CTAGAACGGGCCCAGCATGAGCTGCTGCTGGGGAGTCTGCAGCAGCAGCACCAGGCAGAC
CTGGAGCTCATCGAGAGTGCACACAGAAGCCGCATCAAGGTGCTAGAAACATCGTACCAG
CAACGGGAGGAGCGGCTCCGGAGAGAGAACGAAGAGCTGTCAGCTCGGTATCTGTCGCAG
TGCCAGGAGGCCGAACAGGCCCGTGCTGAGCTTACGGCCCAGCACCAGCGGCGCTTGGCG
GCCATAGCGCAGGAGAAGGACCAGGAAATGGAGCGGCTCCGGGAGCTGCAGCGGGCGTCC
ATCCTAGACATGCGCAGAGACCACGAGGAGCAGCTGCAGCGGCTAAAGCTGCTGAAGGAC
CGAGAGGTCGATGCGGCCACCAGTGCCACCTCCCACACGCGGTCCCTGAATAGCATCATC
CACCAGATGGAGAAGTTCTCCAGCAGCCTGCACGAGTTGTCCTCCCGCGTGGAGGCCTCG
CACCTCACCACCTCCCAGGAGCGGGAGCTGGGGATCCGGCAGCGTGACGAGCAGCTGCGG
GCACTGCAGGAGCGGCTGGGCCAGCAGCAGCGGGACATGGAGGAGGAGCGGAGCCGGCAA
CAGGAGGTCATCGGGAAGATGGAGGCACGGCTGAATGAGCAGAGCCGGCTGCTGGAGCAG
GAACGCTGGCGGGTGACTGCCGAGCAGTCCAAGGCGGAGTCCATGCAGCGCGCCCTAGAG
GAGCAAAGGAAGGTCACGGCCCAGCAGATGGCCATGGAAAGGGCGGAGCTGGAACGGGCC
AAGAGCGCCTTGCTGGAGGAGCAGAAGTCTGTCATGCTCAAGTGCGGGGAGGAGCGGCGG
CGCCTGGCTGCCGAGTGGGCGGAGTTCTCCGCGCAGCAAAAGCTGAGTAAGGAGCGGGCC
GAGCGCGAGGCCGAGCGGGCATTGCAGGTGGACACCCAGCGGGAGGGCACCCTCATCAGC
CTGGCCAAGGAGCAGGCTGAGCTGAAGATCAGGGCCAGCGAGCTCCGGGCCGAGGAGAAG
CAGCTGGCAGCGGAGAGAGCAGCCCTGGAGCAGGAGCGGCAGGAGCTGCGGCTGGAGAAG
GAGAGGATCAACGCCACCGCCCTGCGTGTCAAGCTCCGCGCCGAGGAGGTGGAGAGCATG
AGCAAGGTGGCCTCCGAGAAGTACGAGGAGGGGGAGCGGGCATTGCGCGAGGCCCAGCAG
GTGCAGGCAGAGCAGCAGGCCCGGTTGCAGGCGGTGCAGCAACAGCAGGAGCGGCTGCGG
AAGCAGGAGCAGCACATGCACCAGGAGCATCTGAGTCTGGCCCAGCAGAGGCTGCAACTG
GACCGCGCACGACAGGACCTGCCCTCTAGCCTCGTGGGTCTGTTCCCCAGGGCCCAGGGC
CCTGCAGCCTCCAGCCAGAGTGCCCTCATGCCTCCTGCTCCCACCACCCGTTGGTGCAGC
CAGCCGCCAACTGGCCTGGACCCCAGCCCCTTGCACCTCCATGCCAGGCTGGCACTGCTG
AGGCACATGGCAGAGCAGGACCGTGACTTCTTGGAGAATGAACAGTTCTTCCTGGAGACC
CTGAAGAAAGGGTCCTACAATTTGACATCTCATTCAGCCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:24674
Chromosome Location17
LocusNot Available
References
  1. Sugimoto M, Inoko A, Shiromizu T, Nakayama M, Zou P, Yonemura S, Hayashi Y, Izawa I, Sasoh M, Uji Y, Kaibuchi K, Kiyono T, Inagaki M: The keratin-binding protein Albatross regulates polarization of epithelial cells. J Cell Biol. 2008 Oct 6;183(1):19-28. doi: 10.1083/jcb.200803133. 18838552
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. 16625196
  4. Nagase T, Nakayama M, Nakajima D, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2001 Apr 27;8(2):85-95. 11347906
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Schmidt T, Karsunky H, Frass B, Baum W, Denzel A, Moroy T: A novel protein (Fbf-1) that binds to CD95/APO-1/FAS and shows sequence similarity to trichohyalin and plectin. Biochim Biophys Acta. 2000 Sep 7;1493(1-2):249-54. 10978533
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  8. Jakobsen L, Vanselow K, Skogs M, Toyoda Y, Lundberg E, Poser I, Falkenby LG, Bennetzen M, Westendorf J, Nigg EA, Uhlen M, Hyman AA, Andersen JS: Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods. EMBO J. 2011 Apr 20;30(8):1520-35. doi: 10.1038/emboj.2011.63. Epub 2011 Mar 11. 21399614
  9. Tanos BE, Yang HJ, Soni R, Wang WJ, Macaluso FP, Asara JM, Tsou MF: Centriole distal appendages promote membrane docking, leading to cilia initiation. Genes Dev. 2013 Jan 15;27(2):163-8. doi: 10.1101/gad.207043.112. 23348840