You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameHistone deacetylase 7
Synonyms
  • 3.5.1.98
  • HD7
  • HD7a
  • HDAC7A
  • Histone deacetylase 7A
Gene NameHDAC7
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006797|Histone deacetylase 7
MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVG
PQEQELRQLLHKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPL
ETEGATRSMLSSFLPPVPSLPSDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKE
SAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGSEALLGQRLRLQETSV
APFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGG
TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEP
LPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVV
DDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGHRP
LSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDNSR
HPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNG
FAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQ
DPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRI
VVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLALE
GGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
Number of residues952
Molecular Weight102926.225
Theoretical pI7.6
GO Classification
Functions
  • 14-3-3 protein binding
  • transcription corepressor activity
  • protein kinase binding
  • protein kinase C binding
  • repressing transcription factor binding
  • activating transcription factor binding
  • NAD-dependent histone deacetylase activity (H3-K14 specific)
  • chromatin binding
  • metal ion binding
Processes
  • cellular protein metabolic process
  • negative regulation of interleukin-2 production
  • post-translational protein modification
  • negative regulation of NIK/NF-kappaB signaling
  • negative regulation of osteoblast differentiation
  • negative regulation of transcription from RNA polymerase II promoter
  • positive regulation of cell migration involved in sprouting angiogenesis
  • transcription, DNA-templated
  • Notch signaling pathway
  • vasculogenesis
  • protein sumoylation
  • cell-cell junction assembly
Components
  • nucleoplasm
  • histone deacetylase complex
  • cytoplasm
  • nucleus
General FunctionTranscription corepressor activity
Specific FunctionResponsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer factors such as MEF2A, MEF2B and MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors (By similarity). May be involved in Epstein-Barr virus (EBV) latency, possibly by repressing the viral BZLF1 gene. Positively regulates the transcriptional repressor activity of FOXP3 (PubMed:17360565).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ8WUI4
UniProtKB Entry NameHDAC7_HUMAN
Cellular LocationNucleus
Gene sequence
>lcl|BSEQ0012455|Histone deacetylase 7 (HDAC7)
ATGCACAGCCCCGGCGCTGATGGGACCCAGGTGAGCCCGGGTGCCCACTACTGCAGCCCC
ACTGGCGCAGGCTGCCCCAGGCCCTGTGCAGACACACCAGGCCCTCAGCCGCAGCCCATG
GACCTGCGGGTGGGCCAGCGGCCCCCAGTGGAGCCCCCACCAGAGCCCACATTGCTGGCC
CTGCAGCGTCCCCAGCGCCTGCACCACCACCTCTTCCTAGCAGGCCTGCAGCAGCAGCGC
TCGGTGGAGCCCATGAGGCTCTCCATGGACACGCCGATGCCCGAGTTGCAGGTGGGACCC
CAGGAACAAGAGCTGCGGCAGCTTCTCCACAAGGACAAGAGCAAGCGAAGTGCTGTAGCC
AGCAGCGTGGTCAAGCAGAAGCTAGCGGAGGTGATTCTGAAAAAACAGCAGGCGGCCCTA
GAAAGAACAGTCCATCCCAACAGCCCCGGCATTCCCTACAGAACCCTGGAGCCCCTGGAG
ACGGAAGGAGCCACCCGCTCCATGCTCAGCAGCTTTTTGCCTCCTGTTCCCAGCCTGCCC
AGTGACCCCCCAGAGCACTTCCCTCTGCGCAAGACAGTCTCTGAGCCCAACCTGAAGCTG
CGCTATAAGCCCAAGAAGTCCCTGGAGCGGAGGAAGAATCCACTGCTCCGAAAGGAGAGT
GCGCCCCCCAGCCTCCGGCGGCGGCCCGCAGAGACCCTCGGAGACTCCTCCCCAAGTAGT
AGCAGCACGCCCGCATCAGGGTGCAGCTCCCCCAATGACAGCGAGCACGGCCCCAATCCC
ATCCTGGGCTCGGAGGCTGACAGTGACCGCAGGACCCATCCGACTCTGGGCCCTCGGGGG
CCAATCCTGGGGAGCCCCCACACTCCCCTCTTCCTGCCCCATGGCTTGGAGCCCGAGGCT
GGGGGCACCTTGCCCTCTCGCCTGCAGCCCATTCTCCTCCTGGACCCCTCAGGCTCTCAT
GCCCCGCTGCTGACTGTGCCCGGGCTTGGGCCCTTGCCCTTCCACTTTGCCCAGTCCTTA
ATGACCACCGAGCGGCTCTCTGGGTCAGGCCTCCACTGGCCACTGAGCCGGACTCGCTCA
GAGCCCCTGCCCCCCAGTGCCACCGCTCCCCCACCGCCGGGCCCCATGCAGCCCCGCCTG
GAGCAGCTCAAAACTCACGTCCAGGTGATCAAGAGGTCAGCCAAGCCGAGTGAGAAGCCC
CGGCTGCGGCAGATACCCTCGGCTGAAGACCTGGAGACAGATGGCGGGGGACCGGGCCAG
GTGGTGGACGATGGCCTGGAGCACAGGGAGCTGGGCCATGGGCAGCCTGAGGCCAGAGGC
CCCGCTCCTCTCCAGCAGCACCCTCAGGTGTTGCTCTGGGAACAGCAGCGACTGGCTGGG
CGGCTCCCCCGGGGCAGCACCGGGGACACTGTGCTGCTTCCTCTGGCCCAGGGTGGGCAC
CGGCCTCTGTCCCGGGCTCAGTCTTCCCCAGCCGCACCTGCCTCACTGTCAGCCCCAGAG
CCTGCCAGCCAGGCCCGAGTCCTCTCCAGCTCAGAGACCCCTGCCAGGACCCTGCCCTTC
ACCACAGGGCTGATCTATGACTCGGTCATGCTGAAGCACCAGTGCTCCTGCGGTGACAAC
AGCAGGCACCCGGAGCACGCCGGCCGCATCCAGAGCATCTGGTCCCGGCTGCAGGAGCGG
GGGCTCCGGAGCCAGTGTGAGTGTCTCCGAGGCCGGAAGGCCTCCCTGGAAGAGCTGCAG
TCGGTCCACTCTGAGCGGCACGTGCTCCTCTACGGCACCAACCCGCTCAGCCGCCTCAAA
CTGGACAACGGGAAGCTGGCAGGGCTCCTGGCACAGCGGATGTTTGTGATGCTGCCCTGT
GGTGGGGTTGGGGTGGACACTGACACCATCTGGAATGAGCTTCATTCCTCCAATGCAGCC
CGCTGGGCCGCTGGCAGTGTCACTGACCTCGCCTTCAAAGTGGCTTCTCGTGAGCTAAAG
AATGGTTTCGCTGTGGTGCGGCCCCCAGGACACCATGCAGATCATTCAACAGCCATGGGC
TTCTGCTTCTTCAACTCAGTGGCCATCGCCTGCCGGCAGCTGCAACAGCAGAGCAAGGCC
AGCAAGATCCTCATTGTAGACTGGGACGTGCACCATGGCAACGGCACCCAGCAAACCTTC
TACCAAGACCCCAGTGTGCTCTACATCTCCCTGCATCGCCATGACGACGGCAACTTCTTC
CCGGGGAGTGGGGCTGTGGATGAGGTAGGGGCTGGCAGCGGTGAGGGCTTCAATGTCAAT
GTGGCCTGGGCTGGAGGTCTGGACCCCCCCATGGGGGATCCTGAGTACCTGGCTGCTTTC
AGGATAGTCGTGATGCCCATCGCCCGAGAGTTCTCTCCAGACCTAGTCCTGGTGTCTGCT
GGATTTGATGCTGCTGAGGGTCACCCGGCCCCACTGGGTGGCTACCATGTTTCTGCCAAA
TGTTTTGGATACATGACGCAGCAACTGATGAACCTGGCAGGAGGCGCAGTGGTGCTGGCC
TTGGAGGGTGGCCATGACCTCACAGCCATCTGTGACGCCTCTGAGGCCTGTGTGGCTGCT
CTTCTGGGTAACAGGGTGGATCCCCTTTCAGAAGAAGGCTGGAAACAGAAACCCAACCTC
AATGCCATCCGCTCTCTGGAGGCCGTGATCCGGGTGCACAGTAAATACTGGGGCTGCATG
CAGCGCCTGGCCTCCTGTCCAGACTCCTGGGTGCCTAGAGTGCCAGGGGCTGACAAAGAA
GAAGTGGAGGCAGTGACCGCACTGGCGTCCCTCTCTGTGGGCATCCTGGCTGAAGATAGG
CCCTCGGAGCAGCTGGTGGAGGAGGAAGAACCTATGAATCTCTAA
GenBank Gene IDBC020505
GeneCard IDNot Available
GenAtlas IDHDAC7
HGNC IDHGNC:14067
Chromosome Location12
LocusNot Available
References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  2. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. 16541075
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  5. Lee HJ, Chun M, Kandror KV: Tip60 and HDAC7 interact with the endothelin receptor a and may be involved in downstream signaling. J Biol Chem. 2001 May 18;276(20):16597-600. Epub 2001 Mar 21. 11262386
  6. Fischle W, Dequiedt F, Fillion M, Hendzel MJ, Voelter W, Verdin E: Human HDAC7 histone deacetylase activity is associated with HDAC3 in vivo. J Biol Chem. 2001 Sep 21;276(38):35826-35. Epub 2001 Jul 20. 11466315
  7. Bryant H, Farrell PJ: Signal Transduction and Transcription Factor Modification during Reactivation of Epstein-Barr Virus from Latency. J Virol. 2002 Oct;76(20):10290-8. 12239305
  8. Xiao H, Chung J, Kao HY, Yang YC: Tip60 is a co-repressor for STAT3. J Biol Chem. 2003 Mar 28;278(13):11197-204. Epub 2003 Jan 27. 12551922
  9. Dequiedt F, Martin M, Von Blume J, Vertommen D, Lecomte E, Mari N, Heinen MF, Bachmann M, Twizere JC, Huang MC, Rider MH, Piwnica-Worms H, Seufferlein T, Kettmann R: New role for hPar-1 kinases EMK and C-TAK1 in regulating localization and activity of class IIa histone deacetylases. Mol Cell Biol. 2006 Oct;26(19):7086-102. 16980613
  10. von Blume J, Knippschild U, Dequiedt F, Giamas G, Beck A, Auer A, Van Lint J, Adler G, Seufferlein T: Phosphorylation at Ser244 by CK1 determines nuclear localization and substrate targeting of PKD2. EMBO J. 2007 Nov 14;26(22):4619-33. Epub 2007 Oct 25. 17962809
  11. Barrett A, Santangelo S, Tan K, Catchpole S, Roberts K, Spencer-Dene B, Hall D, Scibetta A, Burchell J, Verdin E, Freemont P, Taylor-Papadimitriou J: Breast cancer associated transcriptional repressor PLU-1/JARID1B interacts directly with histone deacetylases. Int J Cancer. 2007 Jul 15;121(2):265-75. 17373667
  12. Li B, Samanta A, Song X, Iacono KT, Bembas K, Tao R, Basu S, Riley JL, Hancock WW, Shen Y, Saouaf SJ, Greene MI: FOXP3 interactions with histone acetyltransferase and class II histone deacetylases are required for repression. Proc Natl Acad Sci U S A. 2007 Mar 13;104(11):4571-6. Epub 2007 Mar 7. 17360565
  13. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. 18669648
  14. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. 19413330
  15. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. 19690332
  16. Harrison BC, Huynh K, Lundgaard GL, Helmke SM, Perryman MB, McKinsey TA: Protein kinase C-related kinase targets nuclear localization signals in a subset of class IIa histone deacetylases. FEBS Lett. 2010 Mar 19;584(6):1103-10. doi: 10.1016/j.febslet.2010.02.057. Epub 2010 Feb 24. 20188095
  17. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. 20068231
  18. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. 21406692
  19. Satow R, Shitashige M, Jigami T, Fukami K, Honda K, Kitabayashi I, Yamada T: beta-catenin inhibits promyelocytic leukemia protein tumor suppressor function in colorectal cancer cells. Gastroenterology. 2012 Mar;142(3):572-81. doi: 10.1053/j.gastro.2011.11.041. Epub 2011 Dec 9. 22155184
  20. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. 24275569
  21. Schuetz A, Min J, Allali-Hassani A, Schapira M, Shuen M, Loppnau P, Mazitschek R, Kwiatkowski NP, Lewis TA, Maglathin RL, McLean TH, Bochkarev A, Plotnikov AN, Vedadi M, Arrowsmith CH: Human HDAC7 harbors a class IIa histone deacetylase-specific zinc binding motif and cryptic deacetylase activity. J Biol Chem. 2008 Apr 25;283(17):11355-63. doi: 10.1074/jbc.M707362200. Epub 2008 Feb 19. 18285338
  22. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. 16959974