Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtein phosphatase 1 regulatory subunit 1C
Synonyms
  • Inhibitor-5 of protein phosphatase 1
  • IPP5
Gene NamePPP1R1C
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009127|Protein phosphatase 1 regulatory subunit 1C
MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGE
LQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
Number of residues109
Molecular Weight12345.66
Theoretical pINot Available
GO Classification
Functions
  • protein phosphatase inhibitor activity
  • protein serine/threonine phosphatase inhibitor activity
Processes
  • cell division
  • cell cycle
  • negative regulation of protein kinase activity
  • positive regulation of cell growth
  • intracellular signal transduction
  • positive regulation of G1/S transition of mitotic cell cycle
Components
  • cytoplasm
General FunctionProtein serine/threonine phosphatase inhibitor activity
Specific FunctionInhibitor of protein-phosphatase 1. Promotes cell growth and cell cycle progress at the G1/S transition. May increase cell susceptibility to TNF-induced apoptosis.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ8WVI7
UniProtKB Entry NamePPR1C_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0017697|Protein phosphatase 1 regulatory subunit 1C (PPP1R1C)
ATGGAGCCCAACAGTCCCAAAAAGATACAGTTTGCCGTGCCTGTATTCCAGAGTCAGATT
GCACCTGAAGCAGCAGAGCAGATCAGGAAAAGAAGACCTACACCAGCATCACTTGTGATT
CTCAATGAGCATAACCCCCCAGAAATAGATGACAAGAGGGGGCCCAACACACAAGGGGAA
TTACAGAATGCATCCCCTAAGCAAAGGAAGCAGAGTGTGTACACACCACCCACCATAAAA
GGGGTTAAGCATCTGAAAGGCCAGAATGAATCAGCATTCCCTGAAGAAGAAGAAGGCACC
AATGAAAGAGAGGAGCAGCGGGACCATTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:14940
Chromosome Location2
LocusNot Available
References
  1. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  3. Wang X, Liu B, Li N, Li H, Qiu J, Zhang Y, Cao X: IPP5, a novel protein inhibitor of protein phosphatase 1, promotes G1/S progression in a Thr-40-dependent manner. J Biol Chem. 2008 May 2;283(18):12076-84. doi: 10.1074/jbc.M801571200. Epub 2008 Feb 29. 18310074
  4. Zeng Q, Huang Y, Zeng L, Lan X, Huang Y, He S, Zhang H: Effect of IPP5, a novel inhibitor of PP1, on apoptosis and the underlying mechanisms involved. Biotechnol Appl Biochem. 2009 Dec 7;54(4):231-8. doi: 10.1042/BA20090168. 19874272
  5. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. 19139490