You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameSolute carrier family 13 member 3
Synonyms
  • hNaDC3
  • Na(+)/dicarboxylate cotransporter 3
  • NaDC-3
  • NADC3
  • SDCT2
  • Sodium-dependent high-affinity dicarboxylate transporter 2
Gene NameSLC13A3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0001219|Solute carrier family 13 member 3
MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAVYWCTEALPLS
VTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLV
GVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENT
AAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFLISIPY
SASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL
YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRD
PKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKK
AQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTE
FASNTATIIIFLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLL
VKDMVRTGLLMNLMGVLLLSLAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFR
TL
Number of residues602
Molecular Weight66840.355
Theoretical pI8.47
GO Classification
Functions
  • L-aspartate transmembrane transporter activity
  • citrate transmembrane transporter activity
  • high-affinity sodium
  • succinate transmembrane transporter activity
  • sodium
Processes
  • transmembrane transport
  • citrate transport
  • succinate transmembrane transport
Components
  • plasma membrane
  • extracellular exosome
  • integral component of plasma membrane
General FunctionSuccinate transmembrane transporter activity
Specific FunctionHigh-affinity sodium-dicarboxylate cotransporter that accepts a range of substrates with 4-5 carbon atoms. The stoichiometry is probably 3 Na(+) for 1 divalent succinate.
Pfam Domain Function
Transmembrane Regions17-37 56-76 83-103 138-158 230-250 279-299 337-357 373-393 462-482 506-526 547-567
GenBank Protein ID8132324
UniProtKB IDQ8WWT9
UniProtKB Entry NameS13A3_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0018981|Solute carrier family 13 member 3 (SLC13A3)
ATGGCGGTGTACTGGTGCACGGAGGCCCTGCCGCTCTCAGTGACGGCGCTGCTGCCCATC
GTCCTCTTCCCCTTCATGGGCATCTTGCCCTCCAACAAGGTCTGCCCCCAGTACTTCCTC
GACACCAACTTCCTCTTCCTCAGTGGGCTGATCATGGCCAGCGCCATTGAGGAGTGGAAC
CTGCACCGGCGAATCGCCCTCAAGATCCTGATGCTTGTTGGAGTCCAGCCGGCCAGGCTC
ATCCTGGGGATGATGGTGACCACCTCGTTCTTGTCCATGTGGCTGAGCAACACCGCCTCC
ACTGCCATGATGCTTCCCATTGCCAATGCCATCCTGAAAAGTCTCTTTGGCCAGAAGGAG
GTTCGAAAGGACCCCAGCCAGGAGAGTGAAGAGAACACAGCTGCTGTGCGGAGAAACGGC
CTACACACTGTGCCCACGGAGATGCAGTTTCTCGCCAGCACAGAAGCCAAAGACCACCCT
GGGGAGACAGAGGTTCCACTGGATCTGCCGGCTGACTCCAGGAAGGAGGATGAATATCGT
CGGAACATCTGGAAGGGCTTCCTCATCTCCATCCCCTACTCAGCCAGTATTGGGGGCACA
GCCACACTCACGGGCACAGCCCCTAACCTCATCCTGCTTGGCCAGCTCAAGAGTTTCTTT
CCGCAGTGTGACGTGGTGAATTTCGGCTCCTGGTTCATTTTCGCCTTCCCTCTTATGCTG
TTGTTCCTGTTGGCAGGCTGGCTCTGGATCTCCTTCCTGTACGGGGGACTGAGCTTCAGG
GGCTGGAGGAAGAATAAATCTGAGATAAGAACCAATGCAGAAGATAGGGCTCGAGCTGTA
ATTCGGGAAGAATACCAGAACCTGGGGCCCATCAAGTTTGCCGAACAGGCTGTTTTCATC
CTTTTCTGCATGTTTGCCATCCTCCTCTTCACCCGGGACCCGAAGTTCATCCCTGGCTGG
GCCAGCCTCTTCAATCCTGGGTTTCTTTCTGATGCTGTCACCGGCGTGGCTATTGTCACC
ATCTTGTTCTTCTTCCCGTCCCAAAGGCCCTCTCTCAAGTGGTGGTTTGACTTCAAAGCT
CCCAACACAGAGACAGAGCCCTTGCTGACCTGGAAGAAGGCCCAGGAGACAGTGCCCTGG
AACATCATCCTTCTCCTGGGAGGGGGCTTCGCCATGGCCAAAGGCTGTGAGGAATCGGGG
CTGTCTGTATGGATTGGTGGGCAGCTGCACCCCCTGGAGAATGTGCCCCCCGCCCTGGCT
GTGCTGCTCATCACTGTGGTCATCGCCTTCTTCACTGAGTTTGCCAGCAACACGGCGACC
ATCATCATCTTCCTGCCGGTCCTGGCAGAGCTGGCCATCCGCCTGAGAGTGCACCCCCTG
TATCTGATGATTCCGGGCACAGTCGGCTGCTCCTTTGCCTTCATGCTCCCGGTCTCAACG
CCCCCCAACTCCATCGCCTTCGCCTCTGGACACTTGCTGGTCAAAGACATGGTGCGGACA
GGCCTCCTGATGAACCTGATGGGTGTCCTGCTGCTCAGTTTGGCTATGAATACCTGGGCA
CAGACCATCTTCCAGCTGGGCACCTTCCCGGACTGGGCTGATATGTACTCGGTCAATGTC
ACAGCATTGCCACCCACCTTGGCCAATGACACATTTCGGACCCTCTGA
GenBank Gene IDAF154121
GeneCard IDNot Available
GenAtlas IDSLC13A3
HGNC IDHGNC:14430
Chromosome Location20
Locus20q12-q13.1
References
  1. Wang H, Fei YJ, Kekuda R, Yang-Feng TL, Devoe LD, Leibach FH, Prasad PD, Ganapathy V: Structure, function, and genomic organization of human Na(+)-dependent high-affinity dicarboxylate transporter. Am J Physiol Cell Physiol. 2000 May;278(5):C1019-30. 10794676
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. 11780052
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  6. Bai XY, Chen X, Sun AQ, Feng Z, Hou K, Fu B: Membrane topology structure of human high-affinity, sodium-dependent dicarboxylate transporter. FASEB J. 2007 Aug;21(10):2409-17. Epub 2007 Apr 10. 17426067