You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameG protein-activated inward rectifier potassium channel 3
Synonyms
  • GIRK-3
  • GIRK3
  • Inward rectifier K(+) channel Kir3.3
  • Potassium channel, inwardly rectifying subfamily J member 9
Gene NameKCNJ9
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013528|G protein-activated inward rectifier potassium channel 3
MAQENAAFSPGQEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Number of residues393
Molecular Weight44019.45
Theoretical pINot Available
GO Classification
Functions
  • G-protein activated inward rectifier potassium channel activity
Processes
  • synaptic transmission
  • potassium ion import
  • regulation of ion transmembrane transport
Components
  • plasma membrane
  • integral component of plasma membrane
General FunctionG-protein activated inward rectifier potassium channel activity
Specific FunctionThis receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium (By similarity).
Pfam Domain Function
Transmembrane Regions58-82 135-156
GenBank Protein IDNot Available
UniProtKB IDQ92806
UniProtKB Entry NameKCNJ9_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013529|G protein-activated inward rectifier potassium channel 3 (KCNJ9)
ATGGCGCAGGAGAACGCGGCCTTCTCGCCCGGGCAGGAGGAGCCGCCGCGGCGCCGCGGC
CGCCAGCGCTACGTGGAGAAGGATGGCCGGTGCAACGTGCAGCAGGGCAACGTGCGCGAG
ACATACCGCTACCTGACGGACCTGTTCACCACGCTGGTGGACCTGCAGTGGCGCCTCAGC
CTGTTGTTCTTCGTCCTGGCCTACGCGCTCACCTGGCTCTTCTTCGGCGCCATCTGGTGG
CTGATCGCCTACGGCCGCGGCGACCTGGAGCACCTGGAGGACACCGCGTGGACGCCGTGC
GTCAACAACCTCAACGGCTTCGTGGCCGCCTTCCTCTTCTCCATCGAGACCGAGACCACC
ATCGGCTACGGGCACCGCGTCATCACCGACCAGTGCCCCGAGGGCATCGTGCTGCTGCTG
CTGCAGGCCATCCTGGGCTCCATGGTGAACGCCTTCATGGTGGGCTGCATGTTCGTCAAG
ATCTCGCAGCCCAACAAGCGCGCAGCCACGCTCGTCTTCTCCTCGCACGCCGTGGTGTCG
CTGCGCGACGGGCGCCTCTGCCTCATGTTCCGCGTGGGCGACTTGCGCTCCTCACACATA
GTGGAGGCCTCCATCCGCGCCAAGCTCATCCGCTCGCGCCAGACGCTGGAGGGCGAGTTC
ATCCCGCTGCACCAGACCGACCTCAGCGTGGGCTTCGACACGGGAGACGACCGCCTCTTC
CTCGTCTCGCCGCTGGTTATCAGCCACGAGATCGACGCCGCCAGCCCCTTCTGGGAGGCG
TCGCGCCGTGCCCTCGAGAGGGACGACTTCGAGATCGTCGTTATCCTCGAGGGCATGGTG
GAAGCCACGGGAATGACATGCCAAGCTCGGAGCTCCTACCTGGTAGACGAGGTGCTGTGG
GGCCACCGCTTCACGTCAGTGCTGACTCTGGAGGACGGCTTCTACGAAGTGGACTATGCC
AGCTTTCACGAGACTTTTGAGGTGCCCACACCTTCGTGCAGTGCTCGAGAGCTGGCAGAG
GCTGCCGCCCGCCTTGATGCCCATCTCTACTGGTCCATCCCCAGCCGGCTGGATGAGAAG
GTGGAGGAGGAGGGGGCGGGGGAGGGGGCGGGTGGGGAAGCTGGGGCTGACAAGGAGCAG
AATGGCTGCCTGCCACCCCCAGAGAGTGAGTCCAAGGTGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6270
Chromosome Location1
LocusNot Available
References
  1. Schoots O, Wilson JM, Ethier N, Bigras E, Hebert TE, Van Tol HH: Co-expression of human Kir3 subunits can yield channels with different functional properties. Cell Signal. 1999 Dec;11(12):871-83. 10659995
  2. Vaughn J, Wolford JK, Prochazka M, Permana PA: Genomic structure and expression of human KCNJ9 (Kir3.3/GIRK3). Biochem Biophys Res Commun. 2000 Aug 2;274(2):302-9. 10913335
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414