You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameEndonuclease 8-like 1
Synonyms
  • 3.2.2.-
  • DNA glycosylase/AP lyase Neil1
  • DNA-(apurinic or apyrimidinic site) lyase Neil1
  • Endonuclease VIII-like 1
  • FPG1
  • NEH1
  • Nei homolog 1
  • Nei-like protein 1
Gene NameNEIL1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0006196|Endonuclease 8-like 1
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARSVLEALQQHRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKS
KATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPEAPTVPKKGRR
KGRQAASGHCRPRKVKADIPSLEPEGTSAS
Number of residues390
Molecular Weight43683.625
Theoretical pI10.54
GO Classification
Functions
  • hydrolase activity, acting on glycosyl bonds
  • DNA N-glycosylase activity
  • damaged DNA binding
  • protein C-terminus binding
  • DNA-(apurinic or apyrimidinic site) lyase activity
  • zinc ion binding
Processes
  • negative regulation of nuclease activity
  • DNA repair
  • response to oxidative stress
  • nucleotide-excision repair
  • base-excision repair
  • base-excision repair, AP site formation
  • depyrimidination
Components
  • cytoplasm
  • nucleus
  • chromosome
  • nucleoplasm
  • microtubule organizing center
General FunctionNot Available
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ96FI4
UniProtKB Entry NameNEIL1_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0012216|Endonuclease 8-like 1 (NEIL1)
ATGGGGAGGACGGGCCCGAGAGCGCCGCTCCTCCCCAAAACTAGGATTTGGAGCCTCACG
TTCTCCCGCAAAACGAGCCCTGTGGGTGCCAGGCCAGGGGCGGCTCCCAGGTGTGGAGGG
GGCAAGGTACGGGCGTCTGCCGTCGCTAAGTGCCCCCTTCCACTTAAGGCACACCTTCGC
CTCCGATTCCGAACCGCCCGGGGACAGAGGCAAGTGGCAAAGCAGGGAGGGCGGAGGACT
CTGCCACCCTCCCTCAGGATGCCTGAGGGCCCCGAGCTGCACCTGGCCAGCCAGTTTGTG
AATGAGGCCTGCAGGGCGCTGGTGTTCGGCGGCTGCGTGGAGAAGTCCTCTGTCAGCCGC
AACCCTGAGGTGCCCTTTGAGAGCAGTGCCTACCGCATCTCAGCTTCAGCCCGCGGCAAG
GAGCTGCGCCTGATACTGAGCCCTCTGCCTGGGGCCCAGCCCCAACAGGAGCCACTGGCC
CTGGTCTTCCGCTTCGGCATGTCCGGCTCTTTTCAGCTGGTGCCCCGCGAGGAGCTGCCA
CGCCATGCCCACCTGCGCTTTTACACGGCCCCGCCTGGCCCCCGGCTCGCCCTATGTTTC
GTGGACATCCGCCGGTTCGGCCGCTGGGACCTTGGGGGAAAGTGGCAGCCGGGCCGCGGG
CCCTGTGTCTTGCAGGAGTACCAGCAGTTCAGGGAGAATGTGCTACGAAACCTAGCGGAT
AAGGCCTTTGACCGGCCCATCTGCGAGGCCCTCCTGGACCAGAGGTTCTTCAATGGCATT
GGCAACTATCTGCGGGCAGAGATCCTGTACCGGCTGAAGATCCCCCCCTTTGAGAAGGCC
CGCTCGGTCCTGGAGGCCCTGCAGCAGCACAGGCCGAGCCCGGAGCTGACCCTGAGCCAG
AAGATAAGGACCAAGCTGCAGAATCCAGACCTGCTGGAGCTATGTCACTCAGTGCCCAAG
GAAGTGGTCCAGTTGGGGGGCAAAGGCTACGGGTCAGAGAGCGGGGAGGAGGACTTTGCT
GCCTTTCGAGCCTGGCTGCGCTGCTATGGCATGCCAGGCATGAGCTCCCTGCAGGACCGG
CATGGCCGTACCATCTGGTTCCAGGGGGATCCTGGACCGTTGGCACCCAAAGGGCGCAAG
TCCCGCAAAAAGAAATCCAAGGCCACACAGCTGAGTCCTGAGGACAGAGTGGAGGACGCT
TTGCCTCCAAGCAAGGCCCCTTCCAGGACACGAAGGGCAAAGAGAGACCTTCCTAAGAGG
ACTGCAACCCAGCGGCCTGAGGGGACCAGCCTCCAGCAGGACCCAGAAGCTCCCACAGTG
CCCAAGAAGGGGAGGAGGAAGGGGCGACAGGCAGCCTCTGGCCACTGCAGACCCCGGAAG
GTCAAGGCTGACATCCCATCCTTGGAACCAGAGGGGACCTCAGCCTCTTAG
GenBank Gene IDAB079068
GeneCard IDNot Available
GenAtlas IDNEIL1
HGNC IDHGNC:18448
Chromosome LocationNot Available
Locus15q24.2
References
  1. Takao M, Kanno S, Kobayashi K, Zhang QM, Yonei S, van der Horst GT, Yasui A: A back-up glycosylase in Nth1 knock-out mice is a functional Nei (endonuclease VIII) homologue. J Biol Chem. 2002 Nov 1;277(44):42205-13. Epub 2002 Aug 27. 12200441
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. 16572171
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  5. Bandaru V, Sunkara S, Wallace SS, Bond JP: A novel human DNA glycosylase that removes oxidative DNA damage and is homologous to Escherichia coli endonuclease VIII. DNA Repair (Amst). 2002 Jul 17;1(7):517-29. 12509226
  6. Hazra TK, Izumi T, Boldogh I, Imhoff B, Kow YW, Jaruga P, Dizdaroglu M, Mitra S: Identification and characterization of a human DNA glycosylase for repair of modified bases in oxidatively damaged DNA. Proc Natl Acad Sci U S A. 2002 Mar 19;99(6):3523-8. 11904416
  7. Dou H, Mitra S, Hazra TK: Repair of oxidized bases in DNA bubble structures by human DNA glycosylases NEIL1 and NEIL2. J Biol Chem. 2003 Dec 12;278(50):49679-84. Epub 2003 Sep 30. 14522990
  8. Hildrestrand GA, Rolseth V, Bjoras M, Luna L: Human NEIL1 localizes with the centrosomes and condensed chromosomes during mitosis. DNA Repair (Amst). 2007 Oct 1;6(10):1425-33. Epub 2007 Jun 6. 17556049
  9. Yeo J, Goodman RA, Schirle NT, David SS, Beal PA: RNA editing changes the lesion specificity for the DNA repair enzyme NEIL1. Proc Natl Acad Sci U S A. 2010 Nov 30;107(48):20715-9. doi: 10.1073/pnas.1009231107. Epub 2010 Nov 10. 21068368
  10. Doublie S, Bandaru V, Bond JP, Wallace SS: The crystal structure of human endonuclease VIII-like 1 (NEIL1) reveals a zincless finger motif required for glycosylase activity. Proc Natl Acad Sci U S A. 2004 Jul 13;101(28):10284-9. Epub 2004 Jul 1. 15232006
  11. Sanna-Cherchi S, Burgess KE, Nees SN, Caridi G, Weng PL, Dagnino M, Bodria M, Carrea A, Allegretta MA, Kim HR, Perry BJ, Gigante M, Clark LN, Kisselev S, Cusi D, Gesualdo L, Allegri L, Scolari F, D'Agati V, Shapiro LS, Pecoraro C, Palomero T, Ghiggeri GM, Gharavi AG: Exome sequencing identified MYO1E and NEIL1 as candidate genes for human autosomal recessive steroid-resistant nephrotic syndrome. Kidney Int. 2011 Aug;80(4):389-96. doi: 10.1038/ki.2011.148. Epub 2011 Jun 22. 21697813