You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameN-acetylmuramoyl-L-alanine amidase
Synonyms
  • 3.5.1.28
  • Peptidoglycan recognition protein 2
  • Peptidoglycan recognition protein long
  • PGLYRPL
  • PGRP-L
  • PGRPL
Gene NamePGLYRP2
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009532|N-acetylmuramoyl-L-alanine amidase
MAQGVLWILLGLLLWSDPGTASLPLLMDSVIQALAELEQKVPAAKTRHTASAWLMSAPNS
GPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVA
VEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVAIAPDVRATSSPGLRDGSPDV
TTADIGANTPDATKGCPDVQASLPDAKAKSPPTMVDSLLAVTLAGNLGLTFLRGSQTQSH
PDLGTEGCWDQLSAPRTFTLLDPKASLLTMAFLNGALDGVILGDYLSRTPEPRPSLSHLL
SQYYGAGVARDPGFRSNFRRQNGAALTSASILAQQVWGTLVLLQRLEPVHLQLQCMSQEQ
LAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVPAPPCT
DFTRCAANMRSMQRYHQDTQGWGDIGYSFVVGSDGYVYEGRGWHWVGAHTLGHNSRGFGV
AIVGNYTAALPTEAALRTVRDTLPSCAVRAGLLRPDYALLGHRQLVRTDCPGDALFDLLR
TWPHFTATVKPRPARSVSKRSRREPPPRTLPATDLQ
Number of residues576
Molecular Weight62216.365
Theoretical pINot Available
GO Classification
Functions
  • peptidoglycan binding
  • peptidoglycan receptor activity
  • zinc ion binding
  • N-acetylmuramoyl-L-alanine amidase activity
Processes
  • innate immune response
  • regulation of inflammatory response
  • defense response to Gram-positive bacterium
  • peptidoglycan catabolic process
  • detection of bacterium
  • negative regulation of interferon-gamma production
  • peptide amidation
  • growth of symbiont in host
  • negative regulation of natural killer cell differentiation involved in immune response
  • pattern recognition receptor signaling pathway
Components
  • intracellular
  • membrane
  • extracellular exosome
General FunctionZinc ion binding
Specific FunctionMay play a scavenger role by digesting biologically active peptidoglycan (PGN) into biologically inactive fragments. Has no direct bacteriolytic activity.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ96PD5
UniProtKB Entry NamePGRP2_HUMAN
Cellular LocationSecreted
Gene sequence
>lcl|BSEQ0021390|N-acetylmuramoyl-L-alanine amidase (PGLYRP2)
ATGGCCCAGGGTGTCCTCTGGATCCTACTCGGATTGCTACTGTGGTCAGACCCAGGGACA
GCCTCCCTGCCCCTGCTCATGGACTCTGTCATCCAGGCCCTGGCTGAGCTGGAGCAGAAA
GTGCCAGCTGCCAAGACCAGACACACAGCTTCTGCGTGGCTGATGTCAGCTCCAAACTCT
GGCCCCCACAATCGCCTCTACCACTTCCTGCTGGGGGCATGGAGCCTCAATGCTACAGAG
TTGGATCCCTGCCCACTAAGCCCAGAGCTGTTAGGCCTGACCAAGGAGGTGGCCCGACAT
GACGTACGAGAAGGGAAGGAATATGGGGTGGTGCTGGCACCTGATGGCTCGACCGTGGCT
GTGGAGCCTCTGCTGGCGGGGCTGGAGGCAGGGCTGCAAGGGCGCAGGGTCATAAATTTG
CCCTTGGACAGCATGGCTGCCCCTTGGGAGACTGGAGATACCTTTCCAGATGTTGTGGCC
ATTGCTCCAGATGTAAGAGCCACCTCCTCCCCAGGACTCAGGGATGGCTCTCCAGATGTC
ACCACTGCAGATATTGGAGCCAACACTCCAGATGCTACAAAAGGCTGTCCAGATGTCCAA
GCTTCCTTGCCAGATGCCAAAGCCAAGTCCCCACCGACCATGGTGGACAGCCTCCTGGCA
GTCACCCTGGCTGGAAACCTGGGCCTGACCTTCCTCCGAGGTTCCCAGACCCAGAGCCAT
CCAGACCTGGGAACTGAGGGCTGCTGGGACCAGCTCTCTGCCCCTCGGACCTTTACGCTT
TTGGACCCCAAGGCATCTCTGTTAACCATGGCCTTCCTCAATGGCGCCCTGGATGGGGTC
ATCCTTGGAGACTACCTGAGCCGGACTCCTGAGCCCCGGCCATCCCTCAGCCACTTGCTG
AGCCAGTACTATGGGGCTGGGGTGGCCAGAGACCCAGGGTTCCGCAGCAACTTCCGACGG
CAGAACGGTGCTGCTCTGACTTCAGCCTCCATCCTGGCCCAGCAGGTGTGGGGAACCCTT
GTCCTTCTACAGAGGCTGGAGCCAGTACACCTCCAGCTTCAGTGCATGAGCCAAGAACAG
CTGGCCCAGGTGGCTGCCAATGCTACCAAGGAATTCACTGAGGCCTTCCTGGGATGCCCG
GCCATCCACCCCCGCTGCCGCTGGGGAGCGGCGCCTTATCGGGGCCGCCCGAAGCTGCTG
CAGCTGCCGCTGGGATTCTTGTACGTGCATCACACCTACGTGCCTGCACCACCCTGCACG
GACTTCACGCGCTGCGCAGCCAACATGCGCTCCATGCAGCGCTACCACCAGGACACGCAA
GGCTGGGGAGACATCGGCTACAGTTTCGTGGTGGGCTCGGACGGCTACGTGTACGAGGGA
CGCGGCTGGCACTGGGTGGGCGCCCACACGCTCGGCCACAACTCCCGGGGCTTCGGCGTG
GCCATAGTGGGCAACTACACCGCGGCGCTGCCCACCGAGGCCGCTCTGCGCACGGTGCGC
GACACGCTCCCGAGTTGTGCGGTGCGCGCCGGCCTCCTGCGGCCAGACTACGCGCTGCTG
GGCCACCGCCAGCTGGTGCGCACCGACTGCCCCGGCGACGCGCTCTTCGACCTGCTGCGC
ACCTGGCCGCACTTCACCGCGACTGTTAAGCCAAGACCTGCCAGGAGTGTCTCTAAGAGA
TCCAGGAGGGAGCCACCCCCAAGGACCCTGCCAGCCACAGACCTCCAATAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:30013
Chromosome Location19
LocusNot Available
References
  1. Liu C, Xu Z, Gupta D, Dziarski R: Peptidoglycan recognition proteins: a novel family of four human innate immunity pattern recognition molecules. J Biol Chem. 2001 Sep 14;276(37):34686-94. Epub 2001 Jul 18. 11461926
  2. Yamada S, Ohira M, Horie H, Ando K, Takayasu H, Suzuki Y, Sugano S, Hirata T, Goto T, Matsunaga T, Hiyama E, Hayashi Y, Ando H, Suita S, Kaneko M, Sasaki F, Hashizume K, Ohnuma N, Nakagawara A: Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas. Oncogene. 2004 Aug 5;23(35):5901-11. 15221005
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. 12975309
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. De Pauw P, Neyt C, Vanderwinkel E, Wattiez R, Falmagne P: Characterization of human serum N-acetylmuramyl-L-alanine amidase purified by affinity chromatography. Protein Expr Purif. 1995 Jun;6(3):371-8. 7663175
  7. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. 15340161
  8. Zhang Y, van der Fits L, Voerman JS, Melief MJ, Laman JD, Wang M, Wang H, Wang M, Li X, Walls CD, Gupta D, Dziarski R: Identification of serum N-acetylmuramoyl-l-alanine amidase as liver peptidoglycan recognition protein 2. Biochim Biophys Acta. 2005 Aug 31;1752(1):34-46. 16054449
  9. Wang ZM, Li X, Cocklin RR, Wang M, Wang M, Fukase K, Inamura S, Kusumoto S, Gupta D, Dziarski R: Human peptidoglycan recognition protein-L is an N-acetylmuramoyl-L-alanine amidase. J Biol Chem. 2003 Dec 5;278(49):49044-52. Epub 2003 Sep 23. 14506276
  10. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. 12754519
  11. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. 16335952
  12. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. 19159218