You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAdenylate cyclase type 10
Synonyms
  • 4.6.1.1
  • Adenylate cyclase homolog
  • AH-related protein
  • Germ cell soluble adenylyl cyclase
  • hsAC
  • SAC
  • Testicular soluble adenylyl cyclase
Gene NameADCY10
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008830|Adenylate cyclase type 10
MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSS
AMYMDRGAEQLVEILNYHISAIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVI
KCSLEIHGLFETQEWEEGLDIRVKIGLAAGHISMLVFGDETHSHFLVIGQAVDDVRLAQN
MAQMNDVILSPNCWQLCDRSMIEIESVPDQRAVKVNFLKPPPNFNFDEFFTKCTTFMHYY
PSGEHKNLLRLACTLKPDPELEMSLQKYVMESILKQIDNKQLQGYLSELRPVTIVFVNLM
FEDQDKAEEIGPAIQDAYMHITSVLKIFQGQINKVFMFDKGCSFLCVFGFPGEKVPDELT
HALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTVRHEYTVIGQKVNLAARMMMY
YPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKVMFGMACLICNR
KEDYPLLGRNKEINYFMYTMKKFLISNSSQVLMYEGLPGYGKSQILMKIEYLAQGKNHRI
IAISLNKISFHQTFYTIQMFMANVLGLDTCKHYKERQTNLRNKVMTLLDEKFYCLLNDIF
HVQFPISREISRMSTLKKQKQLEILFMKILKLIVKEERIIFIIDEAQFVDSTSWRFMEKL
IRTLPIFIIMSLCPFVNIPCAAARAVIKNRNTTYIVIGAVQPNDISNKICLDLNVSCISK
ELDSYLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEEKTNRTWNNLFKYSIKLTEKLN
MVTLHSDKESEEVCHLTSGVRLKNLSPPTSLKEISLIQLDSMRLSHQMLVRCAAIIGLTF
TTELLFEILPCWNMKMMIKTLATLVESNIFYCFRNGKELQKALKQNDPSFEVHYRSLSLK
PSEGMDHGEEEQLRELENEVIECHRIRFCNPMMQKTAYELWLKDQRKAMHLKCARFLEED
AHRCDHCRGRDFIPYHHFTVNIRLNALDMDAIKKMAMSHGFKTEEKLILSNSEIPETSAF
FPENRSPEEIREKILNFFDHVLTKMKTSDEDIIPLESCQCEEILEIVILPLAHHFLALGE
NDKALYYFLEIASAYLIFCDNYMAYMYLNEGQKLLKTLKKDKSWSQTFESATFYSLKGEV
CFNMGQIVLAKKMLRKALKLLNRIFPYNLISLFLHIHVEKNRHFHYVNRQAQESPPPGKK
RLAQLYRQTVCLSLLWRIYSYSYLFHCKYYAHLAVMMQMNTALETQNCFQIIKAYLDYSL
YHHLAGYKGVWFKYEVMAMEHIFNLPLKGEGIEIVAYVAETLVFNKLIMGHLDLAIELGS
RALQMWALLQNPNRHYQSLCRLSRCLLLNSRYPQLIQVLGRLWELSVTQEHIFSKAFFYF
VCLDILLYSGFVYRTFEECLEFIHQYENNRILKFHSGLLLGLYSSVAIWYARLQEWDNFY
KFSNRAKNLLPRRTMTLTYYDGISRYMEGQVLHLQKQIKEQSENAQASGEELLKNLENLV
AQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESW
YSTSELKEDQWLQTILSLPSWEKIVAGRVNIQDLQKNKFLMRANTVDNHF
Number of residues1610
Molecular Weight187147.545
Theoretical pINot Available
GO Classification
Functions
  • magnesium ion binding
  • bicarbonate binding
  • ATP binding
  • adenylate cyclase activity
  • manganese ion binding
Processes
  • positive regulation of apoptotic process
  • intracellular signal transduction
  • spermatogenesis
  • cAMP biosynthetic process
  • cellular response to inorganic substance
  • epithelial cilium movement
Components
  • cytosol
  • perinuclear region of cytoplasm
  • dendrite
  • growth cone
  • neuronal cell body
  • apical part of cell
  • cytoplasm
  • axon
  • mitochondrion
  • cytoskeleton
  • cilium
  • nucleus
  • basal part of cell
  • plasma membrane
General FunctionManganese ion binding
Specific FunctionCatalyzes the formation of the signaling molecule cAMP (PubMed:12609998, PubMed:15659711, PubMed:24616449, PubMed:25040695, PubMed:24567411). May function as sensor that mediates responses to changes in cellular bicarbonate and CO(2) levels (PubMed:15659711, PubMed:17591988). Has a critical role in mammalian spermatogenesis by producing the cAMP which regulates cAMP-responsive nuclear factors indispensable for sperm maturation in the epididymis. Induces capacitation, the maturational process that sperm undergo prior to fertilization (By similarity). Involved in ciliary beat regulation (PubMed:17591988).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ96PN6
UniProtKB Entry NameADCYA_HUMAN
Cellular LocationCell membrane
Gene sequence
>lcl|BSEQ0021724|Adenylate cyclase type 10 (ADCY10)
ATGTTGGTCTTTGGAGATGAAACACACAGCCACTTTCTGGTGATTGGTCAGGCAGTGGAC
GATGTGCGCCTTGCCCAGAACATGGCTCAGATGAATGATGTTATTCTGTCACCAAACTGC
TGGCAGCTCTGTGACCGGAGCATGATTGAAATTGAGAGTGTTCCAGATCAGAGAGCAGTT
AAGGTTAACTTCTTAAAACCACCCCCCAATTTTAATTTTGATGAATTTTTCACAAAGTGT
ACGACCTTCATGCATTATTATCCTTCTGGTGAGCACAAAAACCTCCTGAGGCTTGCATGC
ACGCTGAAGCCTGATCCTGAACTGGAGATGTCCCTACAAAAGTATGTGATGGAAAGCATT
TTGAAGCAGATTGATAACAAACAGCTTCAGGGCTATTTATCTGAGCTTCGCCCAGTGACG
ATTGTGTTTGTGAACCTGATGTTTGAAGACCAAGACAAAGCAGAAGAGATAGGCCCAGCC
ATCCAGGATGCCTATATGCACATCACTTCTGTCCTGAAGATCTTCCAAGGCCAAATCAAT
AAAGTCTTCATGTTTGACAAGGGCTGCTCTTTCCTCTGTGTCTTTGGCTTCCCTGGGGAA
AAGGTACCTGACGAGCTCACTCATGCTCTGGAATGTGCTATGGATATATTTGACTTCTGC
TCTCAAGTCCACAAAATCCAAACTGTATCCATCGGTGTTGCCAGTGGGATTGTCTTCTGT
GGGATCGTTGGACACACTGTGAGACACGAGTACACAGTCATTGGTCAAAAAGTCAACTTA
GCTGCCAGGATGATGATGTACTACCCAGGAATTGTGACCTGCGACTCTGTCACCTACAAT
GGGAGCAACCTACCAGCGTACTTTTTTAAAGAGCTTCCAAAGAAAGTTATGAAAGGTGTT
GCAGATTCTGGACCATTGTATCAGTATTGGGGCCGTACTGAGAAAGTCATGTTTGGTATG
GCGTGCCTCATCTGCAACAGAAAGGAGGATTACCCTTTGCTGGGACGTAATAAAGAGATC
AACTACTTCATGTATACTATGAAGAAATTTTTGATATCTAACAGCAGCCAAGTCTTAATG
TATGAGGGATTACCAGGATATGGAAAAAGCCAGATACTTATGAAAATTGAGTACCTGGCC
CAAGGTAAGAATCACAGGATTATTGCCATTTCATTGAATAAGATCAGCTTCCATCAAACT
TTCTATACCATCCAGATGTTCATGGCCAATGTCCTAGGCCTAGACACTTGTAAACATTAT
AAAGAACGACAGACCAACCTTCGAAATAAAGTCATGACACTGTTGGATGAAAAGTTCTAC
TGTCTTCTTAATGACATTTTCCATGTTCAGTTCCCTATTTCTCGGGAGATTTCCAGGATG
AGCACCTTGAAAAAGCAAAAACAATTGGAAATATTGTTTATGAAGATCTTGAAGCTGATA
GTGAAAGAGGAAAGGATTATTTTTATCATTGATGAGGCCCAGTTTGTGGATTCGACCTCC
TGGAGATTTATGGAGAAGCTTATCCGGACTCTTCCTATCTTCATCATTATGTCCCTGTGT
CCCTTCGTTAACATTCCCTGTGCAGCTGCCAGGGCCGTAATAAAGAACAGGAACACCACC
TACATTGTCATTGGTGCAGTACAGCCTAACGACATCTCCAACAAGATCTGTCTTGACCTC
AATGTGAGCTGCATCTCCAAAGAACTGGACTCGTACCTGGGGGAGGGAAGCTGTGGGATT
CCATTTTACTGTGAAGAATTGCTTAAAAACCTGGAACATCATGAGGTACTCGTTTTCCAA
CAAACGGAGTCTGAGGAAAAGACAAATAGGACCTGGAATAACCTGTTCAAGTATTCCATT
AAGCTAACAGAGAAGTTAAACATGGTTACTCTCCATAGTGATAAGGAAAGTGAAGAAGTC
TGTCACCTCACAAGTGGTGTCAGACTGAAAAACCTGTCACCTCCAACGTCATTAAAAGAA
ATCTCTCTGATCCAGCTGGATAGCATGAGACTTTCCCACCAAATGCTGGTGAGATGTGCT
GCCATCATTGGCCTGACCTTCACCACTGAGTTGTTGTTTGAGATTCTCCCCTGTTGGAAT
ATGAAGATGATGATCAAGACCCTGGCAACCCTAGTGGAATCTAACATTTTTTATTGTTTC
CGGAATGGCAAGGAGCTTCAAAAGGCCCTGAAACAGAATGATCCCTCATTTGAGGTGCAC
TATCGTTCCTTGTCTCTGAAGCCCAGTGAAGGGATGGATCACGGTGAAGAGGAACAGCTT
CGTGAACTGGAGAATGAGGTGATCGAGTGCCACAGGATTCGATTCTGTAACCCTATGATG
CAGAAAACAGCCTACGAGCTGTGGCTCAAGGACCAGAGAAAAGCCATGCACTTGAAATGT
GCCCGCTTTTTAGAAGAAGATGCCCACAGATGTGACCACTGCCGAGGCAGGGACTTCATT
CCCTATCATCACTTCACAGTGAATATTCGGCTCAACGCTTTAGACATGGATGCCATTAAA
AAGATGGCTATGTCTCATGGATTTAAAACTGAAGAAAAGCTTATCTTGTCCAACTCAGAG
ATTCCTGAGACATCTGCATTTTTTCCTGAAAATCGCAGTCCTGAAGAAATAAGAGAAAAG
ATCTTGAATTTCTTTGACCACGTTTTAACAAAAATGAAGACATCTGACGAAGACATTATC
CCTCTGGAATCTTGCCAGTGTGAAGAAATCCTAGAGATTGTCATCTTGCCTCTGGCCCAC
CATTTTCTGGCTTTGGGAGAAAATGACAAAGCCTTATATTACTTCTTAGAAATTGCATCT
GCTTATCTCATCTTTTGTGATAACTACATGGCATACATGTATTTGAATGAAGGACAGAAG
TTGCTAAAAACTCTCAAGAAGGACAAATCTTGGAGCCAGACATTTGAGTCTGCCACCTTT
TACAGCCTCAAAGGTGAGGTCTGTTTCAATATGGGCCAGATAGTGCTTGCCAAGAAAATG
CTGAGGAAGGCACTGAAGCTCCTCAACCGAATCTTTCCTTACAACTTAATCTCCTTGTTT
CTCCATATCCATGTCGAGAAAAACAGACACTTTCATTATGTGAATCGGCAGGCCCAAGAG
AGCCCACCTCCAGGGAAGAAGAGGCTGGCACAACTTTACCGGCAAACTGTCTGCCTTTCC
TTGCTGTGGCGCATCTATAGCTACAGTTATCTTTTTCACTGCAAGTATTATGCCCACCTG
GCAGTTATGATGCAAATGAATACTGCACTGGAAACTCAAAATTGTTTCCAGATCATTAAG
GCTTACCTAGACTATTCGCTATACCACCACCTGGCTGGCTACAAAGGTGTGTGGTTCAAA
TATGAAGTCATGGCCATGGAGCACATCTTCAACCTCCCCCTGAAAGGCGAGGGCATTGAA
ATCGTGGCATACGTGGCTGAGACACTGGTCTTCAACAAGCTCATAATGGGACACCTGGAT
TTGGCCATTGAGTTAGGCTCCCGAGCCCTTCAGATGTGGGCACTGCTCCAGAATCCCAAC
CGACATTATCAGTCCCTCTGCAGACTTAGCAGATGTCTCCTTCTGAACAGCAGATACCCG
CAATTGATCCAGGTGCTGGGGCGGCTGTGGGAGCTTTCTGTAACACAGGAACACATCTTC
AGCAAGGCATTTTTCTATTTTGTCTGCTTGGACATCCTGCTTTATTCTGGTTTTGTTTAT
AGAACATTTGAAGAATGTTTGGAATTCATACACCAATACGAAAACAACAGAATCCTCAAG
TTCCACAGTGGACTCCTCCTGGGACTTTATTCCTCTGTAGCTATCTGGTATGCCAGACTT
CAGGAATGGGACAACTTTTACAAATTTTCCAATAGAGCTAAAAATCTTTTGCCAAGAAGA
ACCATGACACTTACTTACTATGACGGAATATCTAGGTACATGGAGGGGCAAGTTCTTCAC
CTTCAAAAACAAATCAAAGAACAGTCAGAGAATGCCCAAGCCAGTGGGGAGGAGCTACTC
AAGAACTTGGAGAATCTGGTGGCTCAAAATACCACTGGCCCTGTCTTTTGCCCAAGGCTC
TACCACCTGATGGCTTACGTCTGTATATTAATGGGAGATGGGCAGAAATGTGGCCTCTTC
CTGAACACAGCCTTGCGGCTCTCTGAAACACAGGGGAATATACTGGAGAAATGCTGGCTG
AACATGAACAAAGAATCATGGTACTCAACCTCTGAGTTAAAAGAAGACCAATGGCTTCAG
ACGATCTTGAGTCTCCCATCATGGGAAAAAATTGTAGCAGGCAGGGTAAACATTCAGGAT
CTTCAAAAAAACAAATTCCTGATGAGAGCTAATACCGTGGACAATCATTTCTAA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:21285
Chromosome Location1
LocusNot Available
References
  1. Jaiswal BS, Conti M: Identification and functional analysis of splice variants of the germ cell soluble adenylyl cyclase. J Biol Chem. 2001 Aug 24;276(34):31698-708. Epub 2001 Jun 21. 11423534
  2. Reed BY, Gitomer WL, Heller HJ, Hsu MC, Lemke M, Padalino P, Pak CY: Identification and characterization of a gene with base substitutions associated with the absorptive hypercalciuria phenotype and low spinal bone density. J Clin Endocrinol Metab. 2002 Apr;87(4):1476-85. 11932268
  3. Litvin TN, Kamenetsky M, Zarifyan A, Buck J, Levin LR: Kinetic properties of "soluble" adenylyl cyclase. Synergism between calcium and bicarbonate. J Biol Chem. 2003 May 2;278(18):15922-6. Epub 2003 Feb 27. 12609998
  4. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  5. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Zippin JH, Chen Y, Nahirney P, Kamenetsky M, Wuttke MS, Fischman DA, Levin LR, Buck J: Compartmentalization of bicarbonate-sensitive adenylyl cyclase in distinct signaling microdomains. FASEB J. 2003 Jan;17(1):82-4. Epub 2002 Nov 15. 12475901
  8. Geng W, Wang Z, Zhang J, Reed BY, Pak CY, Moe OW: Cloning and characterization of the human soluble adenylyl cyclase. Am J Physiol Cell Physiol. 2005 Jun;288(6):C1305-16. Epub 2005 Jan 19. 15659711
  9. Schmid A, Sutto Z, Nlend MC, Horvath G, Schmid N, Buck J, Levin LR, Conner GE, Fregien N, Salathe M: Soluble adenylyl cyclase is localized to cilia and contributes to ciliary beat frequency regulation via production of cAMP. J Gen Physiol. 2007 Jul;130(1):99-109. 17591988
  10. Saalau-Bethell SM, Berdini V, Cleasby A, Congreve M, Coyle JE, Lock V, Murray CW, O'Brien MA, Rich SJ, Sambrook T, Vinkovic M, Yon JR, Jhoti H: Crystal structure of human soluble adenylate cyclase reveals a distinct, highly flexible allosteric bicarbonate binding pocket. ChemMedChem. 2014 Apr;9(4):823-32. doi: 10.1002/cmdc.201300480. Epub 2014 Feb 24. 24616449
  11. Kleinboelting S, van den Heuvel J, Steegborn C: Structural analysis of human soluble adenylyl cyclase and crystal structures of its nucleotide complexes-implications for cyclase catalysis and evolution. FEBS J. 2014 Sep;281(18):4151-64. doi: 10.1111/febs.12913. Epub 2014 Jul 28. 25040695
  12. Kleinboelting S, Diaz A, Moniot S, van den Heuvel J, Weyand M, Levin LR, Buck J, Steegborn C: Crystal structures of human soluble adenylyl cyclase reveal mechanisms of catalysis and of its activation through bicarbonate. Proc Natl Acad Sci U S A. 2014 Mar 11;111(10):3727-32. doi: 10.1073/pnas.1322778111. Epub 2014 Feb 24. 24567411