You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameAquaporin-10
Synonyms
  • AQP-10
  • Aquaglyceroporin-10
  • Small intestine aquaporin
Gene NameAQP10
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008799|Aquaporin-10
MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFL
AGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYV
LYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDR
RNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNG
WWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
L
Number of residues301
Molecular Weight31762.97
Theoretical pINot Available
GO Classification
Functions
  • glycerol channel activity
  • water channel activity
  • urea transmembrane transporter activity
Processes
  • transmembrane transport
  • ion transmembrane transport
  • response to toxic substance
  • water transport
  • cellular water homeostasis
  • glycerol transport
  • urea transmembrane transport
Components
  • integral component of plasma membrane
  • plasma membrane
General FunctionWater channel activity
Specific FunctionWater channel required to promote glycerol permeability and water transport across cell membranes. May contribute to water transport in the upper portion of small intestine. Isoform 2 is not permeable to urea and glycerol.
Pfam Domain Function
Transmembrane Regions28-48 53-73 102-122 157-177 188-208
GenBank Protein IDNot Available
UniProtKB IDQ96PS8
UniProtKB Entry NameAQP10_HUMAN
Cellular LocationMembrane
Gene sequence
>lcl|BSEQ0013422|Aquaporin-10 (AQP10)
ATGGTCTTCACTCAGGCCCCGGCTGAAATCATGGGCCACCTCCGGATACGCAGCCTCCTG
GCCCGGCAGTGCCTGGCAGAGTTTCTGGGTGTGTTTGTACTCATGCTCCTCACCCAAGGA
GCTGTGGCCCAGGCTGTCACCAGTGGAGAAACCAAAGGCAACTTCTTCACCATGTTTCTG
GCTGGCTCTCTGGCCGTTACGATAGCCATCTACGTGGGTGGTAACGTCTCAGGGGCCCAC
CTGAATCCAGCCTTCTCCCTGGCCATGTGCATCGTTGGACGCCTCCCCTGGGTCAAGCTC
CCCATTTACATCTTGGTGCAGTTGCTGTCTGCTTTCTGTGCTTCGGGAGCCACCTATGTT
CTCTACCATGATGCCCTACAGAACTATACAGGTGGGAACCTGACAGTGACTGGCCCCAAG
GAGACAGCCTCCATTTTTGCCACCTATCCTGCCCCCTATCTGTCCCTGAACAATGGCTTC
CTGGATCAGGTTCTGGGCACTGGGATGCTGATTGTGGGGCTCTTGGCCATCCTGGACAGA
CGGAACAAGGGAGTCCCTGCGGGTCTGGAGCCTGTGGTGGTGGGGATGCTGATCCTGGCC
CTCGGGTTATCCATGGGTGCCAACTGCGGGATTCCACTCAACCCTGCCCGGGACCTGGGC
CCACGTCTCTTCACCTACGTGGCTGGCTGGGGTCCTGAAGTCTTCAGTGCTGGTAATGGC
TGGTGGTGGGTGCCTGTGGTGGCCCCTCTGGTGGGGGCCACCGTTGGCACAGCCACTTAC
CAGCTGTTGGTGGCTCTGCACCACCCTGAGGGCCCAGAGCCAGCTCAGGATCTGGTGTCT
GCTCAACACAAAGCCTCAGAGTTGGAAACTCCTGCCTCAGCTCAGATGCTGGAGTGTAAG
CTATGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:16029
Chromosome Location1
LocusNot Available
References
  1. Hatakeyama S, Yoshida Y, Tani T, Koyama Y, Nihei K, Ohshiro K, Kamiie JI, Yaoita E, Suda T, Hatakeyama K, Yamamoto T: Cloning of a new aquaporin (AQP10) abundantly expressed in duodenum and jejunum. Biochem Biophys Res Commun. 2001 Oct 5;287(4):814-9. 11573934
  2. Ishibashi K, Morinaga T, Kuwahara M, Sasaki S, Imai M: Cloning and identification of a new member of water channel (AQP10) as an aquaglyceroporin. Biochim Biophys Acta. 2002 Jul 19;1576(3):335-40. 12084581
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. 16710414
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334