You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameProtamine-3
Synonyms
  • Sperm protamine P3
Gene NamePRM3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013455|Protamine-3
MGSRCAKLNTGQSPGHSPGHSTGHGRGHESSMKKLMACVSQDNFSLSSAGEEEEEEEEEG
EEEEKEELPVQGKLLLLEPERQEEGQKDNAEAQQSPEPKQTPS
Number of residues103
Molecular Weight11232.01
Theoretical pINot Available
GO Classification
Functions
  • DNA binding
Processes
  • cell differentiation
  • multicellular organismal development
  • sperm motility
  • spermatogenesis
  • chromosome condensation
Components
  • nucleus
  • nucleosome
  • cytoplasm
General FunctionDna binding
Specific FunctionProtamines substitute for histones in the chromatin of sperm during the haploid phase of spermatogenesis. They compact sperm DNA into a highly condensed, stable and inactive complex (By similarity).
Pfam Domain FunctionNot Available
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9NNZ6
UniProtKB Entry NamePRM3_HUMAN
Cellular LocationNucleus
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:13732
Chromosome LocationNot Available
LocusNot Available
References
  1. Schluter G, Celik A, Obata R, Schlicker M, Hofferbert S, Schlung A, Adham IM, Engel W: Sequence analysis of the conserved protamine gene cluster shows that it contains a fourth expressed gene. Mol Reprod Dev. 1996 Jan;43(1):1-6. 8720108