You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameInositol-3-phosphate synthase 1
Synonyms
  • 5.5.1.4
  • hINO1
  • hIPS
  • INO1
  • IPS 1
  • MI-1-P synthase
  • MIP synthase
  • Myo-inositol 1-phosphate synthase
  • Myo-inositol 1-phosphate synthase A1
Gene NameISYNA1
OrganismHuman
Amino acid sequence
>lcl|BSEQ0009417|Inositol-3-phosphate synthase 1
MEAAAQFFVESPDVVYGPEAIEAQYEYRTTRVSREGGVLKVHPTSTRFTFRTARQVPRLG
VMLVGWGGNNGSTLTAAVLANRLRLSWPTRSGRKEANYYGSLTQAGTVSLGLDAEGQEVF
VPFSAVLPMVAPNDLVFDGWDISSLNLAEAMRRAKVLDWGLQEQLWPHMEALRPRPSVYI
PEFIAANQSARADNLIPGSRAQQLEQIRRDIRDFRSSAGLDKVIVLWTANTERFCEVIPG
LNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLNGSPQNTLVPGALELAWQHRVFVG
GDDFKSGQTKVKSVLVDFLIGSGLKTMSIVSYNHLGNNDGENLSAPLQFRSKEVSKSNVV
DDMVQSNPVLYTPGEEPDHCVVIKYVPYVGDSKRALDEYTSELMLGGTNTLVLHNTCEDS
LLAAPIMLDLALLTELCQRVSFCTDMDPEPQTFHPVLSLLSFLFKAPLVPPGSPVVNALF
RQRSCIENILRACVGLPPQNHMLLEHKMERPGPSLKRVGPVAATYPMLNKKGPVPAATNG
CTGDANGHLQEEPPMPTT
Number of residues558
Molecular Weight61067.285
Theoretical pINot Available
GO Classification
Functions
  • inositol-3-phosphate synthase activity
Processes
  • small molecule metabolic process
  • phospholipid biosynthetic process
  • inositol biosynthetic process
  • inositol phosphate metabolic process
Components
  • cytosol
General FunctionInositol-3-phosphate synthase activity
Specific FunctionKey enzyme in myo-inositol biosynthesis pathway that catalyzes the conversion of glucose 6-phosphate to 1-myo-inositol 1-phosphate in a NAD-dependent manner. Rate-limiting enzyme in the synthesis of all inositol-containing compounds.
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9NPH2
UniProtKB Entry NameINO1_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013145|Inositol-3-phosphate synthase 1 (ISYNA1)
ATGGAGGCCGCCGCCCAGTTCTTCGTCGAGAGCCCGGACGTGGTCTACGGCCCCGAGGCC
ATCGAGGCGCAATACGAGTACCGGACGACGCGCGTCAGCCGCGAGGGTGGCGTTCTCAAG
GAGGCCAACTACTACGGCTCGCTGACTCAGGCGGGCACCGTGAGCCTGGGCCTGGACGCC
GAGGGCCAGGAGGTGTTCGTACCCTTCAGCGCGGTGCTGCCCATGGTGGCGCCCAACGAC
CTCGTGTTCGATGGCTGGGACATCTCGTCGCTGAACCTGGCCGAGGCGATGCGGCGCGCG
AAGGTGCTGGACTGGGGGCTGCAGGAGCAACTGTGGCCGCACATGGAGGCCCTGCGGCCC
CGGCCTTCTGTTTACATCCCCGAATTCATCGCGGCCAACCAGAGCGCGCGCGCGGACAAC
CTCATCCCAGGCTCGCGTGCGCAGCAGCTGGAGCAGATCCGCAGGGACATCCGAGACTTC
CGGTCTAGCGCGGGGCTGGACAAAGTCATAGTGCTGTGGACGGCGAACACGGAGCGCTTC
TGTGAGGTGATTCCAGGCCTCAACGACACAGCCGAGAACCTGCTGCGCACCATTGAGCTC
GGTCTGGAGGTGTCGCCCTCCACGCTCTTCGCCGTGGCCAGCATCCTGGAGGGCTGTGCC
TTCCTCAATGGGTCTCCGCAGAACACCCTGGTGCCCGGAGCTCTTGAGCTCGCGTGGCAG
CACCGGGTTTTTGTGGGCGGAGATGACTTCAAGTCAGGCCAGACCAAAGTCAAGTCCGTG
CTTGTGGACTTCCTCATTGGCTCCGGCCTCAAGACCATGTCCATCGTGAGTTACAACCAC
CTGGGCAACAACGATGGGGAGAACCTATCGGCGCCATTGCAGTTCCGCTCTAAGGAGGTG
TCCAAGAGCAACGTGGTGGACGACATGGTGCAGAGCAACCCAGTGCTCTATACGCCCGGC
GAAGAGCCTGACCACTGCGTGGTCATCAAGTATGTGCCGTACGTGGGTGACAGCAAGCGC
GCGCTGGATGAGTATACCTCGGAGCTGATGCTGGGCGGAACCAACACACTGGTGCTGCAC
AACACGTGTGAGGACTCGCTGCTGGCCGCACCCATCATGCTGGACCTAGCGCTGCTGACC
GAGCTGTGCCAGCGCGTGAGCTTCTGCACTGACATGGACCCCGAGCCGCAGACCTTCCAC
CCCGTGCTGTCCCTGCTCAGCTTCCTCTTCAAGGCGCCACTAGTGCCGCCCGGCAGCCCG
GTGGTCAATGCGCTTTTCCGCCAGCGCAGCTGCATCGAGAACATCCTCAGGGCCTGCGTG
GGGCTCCCGCCACAGAACCACATGCTCCTGGAACACAAAATGGAGCGCCCAGGGCCCAGC
CTCAAGCGAGTTGGACCCGTGGCTGCCACCTACCCTATGTTGAACAAGAAAGGACCGGTA
CCCGCTGCCACCAATGGCTGCACCGGTGATGCCAATGGGCATCTGCAAGAGGAGCCCCCA
ATGCCCACCACCTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:29821
Chromosome Location19
LocusNot Available
References
  1. Guan G, Dai P, Shechter I: cDNA cloning and gene expression analysis of human myo-inositol 1-phosphate synthase. Arch Biochem Biophys. 2003 Sep 15;417(2):251-9. 12941308
  2. Parthasarathy LK, Seelan RS, Tobias C, Casanova MF, Parthasarathy RN: Mammalian inositol 3-phosphate synthase: its role in the biosynthesis of brain inositol and its clinical use as a psychoactive agent. Subcell Biochem. 2006;39:293-314. 17121280
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. 14702039
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. 17974005
  5. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. 15057824
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  7. Seelan RS, Parthasarathy LK, Parthasarathy RN: E2F1 regulation of the human myo-inositol 1-phosphate synthase (ISYNA1) gene promoter. Arch Biochem Biophys. 2004 Nov 1;431(1):95-106. 15464731
  8. Ju S, Shaltiel G, Shamir A, Agam G, Greenberg ML: Human 1-D-myo-inositol-3-phosphate synthase is functional in yeast. J Biol Chem. 2004 May 21;279(21):21759-65. Epub 2004 Mar 15. 15024000
  9. Shamir A, Shaltiel G, Mark S, Bersudsky Y, Belmaker RH, Agam G: Human MIP synthase splice variants in bipolar disorder. Bipolar Disord. 2007 Nov;9(7):766-71. 17988368
  10. Shaltiel G, Mark S, Kofman O, Belmaker RH, Agam G: Effect of valproate derivatives on human brain myo-inositol-1-phosphate (MIP) synthase activity and amphetamine-induced rearing. Pharmacol Rep. 2007 Jul-Aug;59(4):402-7. 17901568
  11. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460