You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameMitochondrial dicarboxylate carrier
Synonyms
  • DIC
  • Solute carrier family 25 member 10
Gene NameSLC25A10
OrganismHuman
Amino acid sequence
>lcl|BSEQ0004438|Mitochondrial dicarboxylate carrier
MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILAL
YSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPA
DLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLS
CYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHC
AVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS
Number of residues287
Molecular Weight31282.21
Theoretical pI9.91
GO Classification
Functions
  • dicarboxylic acid transmembrane transporter activity
Processes
  • dicarboxylic acid transport
  • mitochondrial transport
  • gluconeogenesis
  • cellular nitrogen compound metabolic process
  • small molecule metabolic process
  • carbohydrate metabolic process
  • glucose metabolic process
  • transmembrane transport
  • sulfur amino acid metabolic process
  • sulfur amino acid catabolic process
  • sulfide oxidation, using sulfide
  • ion transport
Components
  • mitochondrial inner membrane
  • integral component of membrane
  • nucleus
General FunctionDicarboxylic acid transmembrane transporter activity
Specific FunctionInvolved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane.
Pfam Domain Function
Transmembrane Regions10-30 63-82 103-123 163-182 203-223 255-275
GenBank Protein ID6224534
UniProtKB IDQ9UBX3
UniProtKB Entry NameDIC_HUMAN
Cellular LocationMitochondrion inner membrane
Gene sequence
>lcl|BSEQ0020601|Mitochondrial dicarboxylate carrier (SLC25A10)
ATGGCAGCCGAGGCGCGCGTGTCGCGCTGGTACTTCGGGGGGCTGGCCTCCTGCGGGGCC
GCCTGCTGCACGCACCCGCTGGACCTGCTCAAGGTGCATCTGCAGACGCAGCAGGAGGTG
AAGCTGCGCATGACGGGCATGGCGCTGCGGGTGGTGCGTACCGACGGCATCCTGGCACTC
TACAGCGGCCTGAGCGCCTCGCTGTGCAGACAGATGACCTACTCCCTGACTCGGTTCGCC
ATCTACGAGACTGTGCGGGACCGTGTGGCCAAGGGCAGCCAGGGGCCTCTCCCCTTCCAC
GAGAAGGTGTTGCTGGGCTCCGTCAGCGGTTTAGCTGGAGGCTTCGTGGGGACGCCCGCA
GACTTGGTCAACGTCAGGATGCAGAACGACGTGAAGCTGCCCCAGGGTCAGCGGCGCAAC
TACGCCCATGCGCTGGATGGCCTGTACCGCGTAGCTCGTGAAGAGGGTCTCAGGAGACTG
TTCTCGGGTGCAACCATGGCATCCAGCCGAGGGGCCTTAGTCACTGTGGGCCAGCTGTCC
TGCTACGACCAGGCCAAGCAGCTGGTCCTTAGCACCGGGTACCTCTCTGACAACATCTTC
ACTCACTTTGTCGCCAGCTTTATTGCAGCCGCTGGTGACGAGCCCCCTCCTCAGGGTGGA
TGTGCCACGTTCCTGTGCCAGCCCCTGGATGTGCTGAAGACTCGCCTGATGAACTCCAAG
GGGGAGTATCAGGGCGTTTTCCACTGCGCCGTGGAGACAGCGAAGCTCGGGCCTCTGGCC
TTTTACAAGGGCCTCGTCCCAGCTGGCATCCGCCTCATCCCCCACACCGTGCTCACTTTT
GTGTTTCTGGAACAGCTACGCAAAAACTTTGGCATCAAAGTGCCATCCTGA
GenBank Gene IDAJ131612
GeneCard IDNot Available
GenAtlas IDSLC25A10
HGNC IDHGNC:10980
Chromosome Location17
Locus17q25.3
References
  1. Fiermonte G, Dolce V, Arrigoni R, Runswick MJ, Walker JE, Palmieri F: Organization and sequence of the gene for the human mitochondrial dicarboxylate carrier: evolution of the carrier family. Biochem J. 1999 Dec 15;344 Pt 3:953-60. 10585886
  2. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. 16303743
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. 21269460