Tmic
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameGamma-aminobutyric acid receptor subunit theta
Synonyms
  • GABA(A) receptor subunit theta
Gene NameGABRQ
OrganismHuman
Amino acid sequence
>lcl|BSEQ0012499|Gamma-aminobutyric acid receptor subunit theta
MGIRGMLRAAVILLLIRTWLAEGNYPSPIPKFHFEFSSAVPEVVLNLFNCKNCANEAVVQ
KILDRVLSRYDVRLRPNFGGAPVPVRISIYVTSIEQISEMNMDYTITMFFHQTWKDSRLA
YYETTLNLTLDYRMHEKLWVPDCYFLNSKDAFVHDVTVENRVFQLHPDGTVRYGIRLTTT
AACSLDLHKFPMDKQACNLVVESYGYTVEDIILFWDDNGNAIHMTEELHIPQFTFLGRTI
TSKEVYFYTGSYIRLILKFQVQREVNSYLVQVYWPTVLTTITSWISFWMNYDSSAARVTI
GLTSMLILTTIDSHLRDKLPNISCIKAIDIYILVCLFFVFLSLLEYVYINYLFYSRGPRR
QPRRHRRPRRVIARYRYQQVVVGNVQDGLINVEDGVSSLPITPAQAPLASPESLGSLTST
SEQAQLATSESLSPLTSLSGQAPLATGESLSDLPSTSEQARHSYGVRFNGFQADDSIFPT
EIRNRVEAHGHGVTHDHEDSNESLSSDERHGHGPSGKPMLHHGEKGVQEAGWDLDDNNDK
SDCLAIKEQFKCDTNSTWGLNDDELMAHGQEKDSSSESEDSCPPSPGCSFTEGFSFDLFN
PDYVPKVDKWSRFLFPLAFGLFNIVYWVYHMY
Number of residues632
Molecular Weight72020.875
Theoretical pI5.76
GO Classification
Functions
  • chloride channel activity
  • GABA-A receptor activity
  • neurotransmitter transporter activity
  • transmembrane signaling receptor activity
  • extracellular ligand-gated ion channel activity
Processes
  • ion transmembrane transport
  • chloride transmembrane transport
  • neurotransmitter transport
  • regulation of membrane potential
  • neurological system process
  • synaptic transmission
  • signal transduction
  • transmembrane transport
Components
  • postsynaptic membrane
  • synapse
  • neuron projection
  • plasma membrane
  • receptor complex
  • chloride channel complex
  • cell junction
  • GABA-A receptor complex
  • integral component of plasma membrane
General FunctionTransmembrane signaling receptor activity
Specific FunctionGABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Pfam Domain Function
Transmembrane Regions269-289 327-347 612-632
GenBank Protein ID7861736
UniProtKB IDQ9UN88
UniProtKB Entry NameGBRT_HUMAN
Cellular LocationCell junction
Gene sequence
>lcl|BSEQ0012500|Gamma-aminobutyric acid receptor subunit theta (GABRQ)
ATGGGCATCCGAGGCATGCTGCGAGCCGCAGTGATCCTGCTGCTCATCAGGACCTGGCTC
GCGGAGGGCAACTACCCCAGTCCCATCCCGAAATTCCACTTCGAGTTCTCCTCTGCTGTG
CCCGAAGTCGTCCTGAACCTCTTCAACTGCAAAAATTGTGCAAATGAAGCTGTGGTTCAA
AAGATTTTGGACAGGGTGCTGTCAAGATACGATGTCCGCCTGAGACCGAATTTTGGAGGT
GCCCCTGTGCCTGTGAGAATATCTATTTATGTCACGAGCATTGAACAGATCTCAGAAATG
AATATGGACTACACGATCACGATGTTTTTTCATCAGACTTGGAAAGATTCACGCTTAGCA
TACTATGAGACCACCCTGAACTTGACCCTGGACTATCGGATGCATGAGAAGTTGTGGGTC
CCTGACTGCTACTTTCTGAACAGCAAGGATGCTTTCGTGCATGATGTGACTGTGGAGAAT
CGCGTGTTTCAGCTTCACCCAGATGGAACGGTGCGGTACGGCATCCGACTCACCACTACA
GCAGCTTGTTCCCTGGATCTGCATAAATTCCCTATGGACAAGCAGGCCTGCAACCTGGTG
GTAGAGAGCTATGGTTACACGGTTGAAGACATCATATTATTCTGGGATGACAATGGGAAC
GCCATCCACATGACTGAGGAGCTGCATATCCCTCAGTTCACTTTCCTGGGAAGGACGATT
ACTAGCAAGGAGGTGTATTTCTACACAGGTTCCTACATACGCCTGATACTGAAGTTCCAG
GTTCAGAGGGAAGTTAACAGCTACCTTGTGCAAGTCTACTGGCCTACTGTCCTCACCACT
ATTACCTCTTGGATATCGTTTTGGATGAACTATGATTCCTCTGCAGCCAGGGTGACAATT
GGCTTAACTTCAATGCTCATCCTGACCACCATCGACTCACATCTGCGGGATAAGCTCCCC
AACATTTCCTGTATCAAGGCCATTGATATCTATATCCTCGTGTGCTTGTTCTTTGTGTTC
CTGTCCTTGCTGGAGTATGTCTACATCAACTATCTTTTCTACAGTCGAGGACCTCGGCGC
CAGCCTAGGCGACACAGGAGACCCCGAAGAGTCATTGCCCGCTACCGCTACCAGCAAGTG
GTGGTAGGAAACGTGCAGGATGGCCTGATTAACGTGGAAGACGGAGTCAGCTCTCTCCCC
ATCACCCCAGCGCAGGCCCCCCTGGCAAGCCCGGAAAGCCTCGGTTCTTTGACGTCCACC
TCCGAGCAGGCCCAGCTGGCCACCTCGGAAAGCCTCAGCCCACTCACTTCTCTCTCAGGC
CAGGCCCCCCTGGCCACTGGAGAAAGCCTGAGCGATCTCCCCTCCACCTCAGAGCAGGCC
CGGCACAGCTATGGTGTTCGCTTTAATGGTTTCCAGGCTGATGACAGTATTATTCCTACC
GAAATCCGCAACCGTGTCGAAGCCCATGGCCATGGTGTTACCCATGACCATGAAGATTCC
AATGAGAGCTTGAGCTCGGATGAGCGCCATGGCCATGGCCCCAGTGGGAAGCCCATGCTT
CACCATGGCGAGAAGGGTGTGCAAGAAGCAGGCTGGGACCTTGATGACAACAATGACAAG
AGCGACTGCCTTGCCATTAAGGAGCAATTCAAGTGTGATACTAACAGTACCTGGGGCCTT
AATGATGATGAGCTCATGGCCCATGGCCAAGAGAAGGACAGTAGCTCAGAGTCTGAGGAT
AGTTGCCCCCCAAGCCCTGGGTGCTCCTTCACTGAAGGGTTCTCCTTCGATCTCTTTAAT
CCTGACTACGTCCCAAAGGTCGACAAGTGGTCCCGGTTCCTCTTCCCTCTGGCCTTTGGG
TTGTTCAACATTGTTTACTGGGTATACCATATGTATTAG
GenBank Gene IDAF189259
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:14454
Chromosome LocationX
LocusNot Available
References
  1. Sinkkonen ST, Hanna MC, Kirkness EF, Korpi ER: GABA(A) receptor epsilon and theta subunits display unusual structural variation between species and are enriched in the rat locus ceruleus. J Neurosci. 2000 May 15;20(10):3588-95. 10804200
  2. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. 15772651
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  4. Bonnert TP, McKernan RM, Farrar S, le Bourdelles B, Heavens RP, Smith DW, Hewson L, Rigby MR, Sirinathsinghji DJ, Brown N, Wafford KA, Whiting PJ: theta, a novel gamma-aminobutyric acid type A receptor subunit. Proc Natl Acad Sci U S A. 1999 Aug 17;96(17):9891-6. 10449790