You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameC-Jun-amino-terminal kinase-interacting protein 3
Synonyms
  • JIP-3
  • JIP3
  • JNK MAP kinase scaffold protein 3
  • KIAA1066
  • Mitogen-activated protein kinase 8-interacting protein 3
Gene NameMAPK8IP3
OrganismHuman
Amino acid sequence
>lcl|BSEQ0008777|C-Jun-amino-terminal kinase-interacting protein 3
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQ
LQSSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNESLQPLGDYGV
GSKNSKRAREKRDSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRLD
RTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDDFFGMGKEV
GNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKELE
EELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYKE
RLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY
KSPTTAGFSQRRNHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGR
LQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWRP
NEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTL
TTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDPGAD
GVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEVATIANGKVNPSQSTEEATEATE
VPDPGPSEPETATLRPGPLTEHVFTDPAPTPSSGPQPGSENGPEPDSSSTRPEPEPSGDP
TGAGSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGT
LAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEKS
FDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKL
GFSFVRITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARP
GGIIHVYGDDSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDS
PAEGPGPAAPASEVEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGAGDMSQVKPVLSK
AERSHIIVWQVSYTPE
Number of residues1336
Molecular Weight147455.935
Theoretical pINot Available
GO Classification
Functions
  • kinesin binding
  • MAP-kinase scaffold activity
  • receptor signaling complex scaffold activity
  • JUN kinase binding
Processes
  • regulation of JNK cascade
  • in utero embryonic development
  • axon guidance
  • activation of JUN kinase activity
  • post-embryonic development
  • regulation of gene expression
  • forebrain development
  • protein localization
  • respiratory gaseous exchange
  • lung alveolus development
  • lung morphogenesis
  • vesicle-mediated transport
Components
  • Golgi membrane
  • dendrite
  • axolemma
  • smooth endoplasmic reticulum
  • cytoplasm
General FunctionReceptor signaling complex scaffold activity
Specific FunctionThe JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. May function as a regulator of vesicle transport, through interactions with the JNK-signaling components and motor proteins (By similarity).
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9UPT6
UniProtKB Entry NameJIP3_HUMAN
Cellular LocationCytoplasm
Gene sequence
>lcl|BSEQ0013410|C-Jun-amino-terminal kinase-interacting protein 3 (MAPK8IP3)
ATGATGGAGATCCAGATGGACGAGGGCGGCGGCGTGGTGGTGTACCAGGACGACTACTGC
TCCGGCTCGGTGATGTCGGAGCGGGTGTCGGGCCTGGCGGGCTCCATCTACCGCGAGTTC
GAGCGCCTCATCCACTGCTACGACGAGGAGGTGGTCAAGGAGCTCATGCCGCTGGTGGTG
AACGTGCTGGAGAACCTAGACTCGGTGCTCAGCGAGAACCAGGAGCACGAGGTGGAGCTG
GAGCTGCTGCGCGAGGACAACGAGCAGCTGCTCACCCAGTACGAGCGTGAGAAGGCGCTG
CGCAGGCAGGCGGAGGAGAAATTCATTGAGTTTGAAGATGCTCTGGAACAAGAGAAGAAA
GAGCTGCAAATCCAGGTGGAGCACTACGAGTTCCAGACGCGCCAGCTGGAGCTGAAGGCC
AAGAACTATGCCGATCAGATTTCCCGGTTGGAGGAGCGGGAGTCGGAGATGAAGAAGGAG
TACAATGCCCTGCACCAGCGGCACACAGAGATGATACAGACCTACGTGGAGCACATTGAG
AGGTCCAAGATGCAGCAGGTCGGAGGAAACAGCCAGACCGAGAGCAGCCTGCCGGGGCGG
AGGAAGGAGCGCCCCACCTCCCTGAACGTGTTCCCCCTGGCTGACGGCACGGTACGTGCA
CAGATCGGGGGCAAGCTCGTGCCTGCGGGGGACCACTGGCACCTGAGTGACCTCGGCCAG
CTGCAGTCCAGCTCCAGCTACCAGTGTCCACAGGATGAAATGTCCGAGTCAGGCCAGTCC
TCGGCGGCCGCCACACCCAGCACCACAGGCACCAAGTCCAACACGCCCACATCCTCCGTG
CCCTCGGCCGCCGTCACACCCCTCAACGAGAGCCTGCAGCCCCTGGGGGACTATGGCGTG
GGCTCCAAGAACAGCAAGCGTGCCCGGGAGAAGCGCGACAGCCGCAACATGGAAGTACAG
GTCACCCAGGAGATGCGCAACGTCAGTATAGGCATGGGCAGCAGTGACGAGTGGTCTGAT
GTTCAAGACATTATTGACTCCACGCCAGAGCTGGACATGTGTCCAGAGACCCGCCTGGAC
CGCACAGGAAGCAGCCCAACCCAGGGCATCGTGAACAAAGCTTTCGGCATCAACACCGAC
TCCCTGTACCATGAGCTGTCGACGGCAGGGTCTGAGGTCATCGGGGATGTGGACGAAGGG
GCCGACCTCCTAGGGGAGTTCTCAGGAATGGGCAAAGAAGTGGGGAATCTGCTACTGGAA
AACTCACAGCTTCTGGAAACCAAAAACGCCTTGAATGTGGTGAAGAATGACCTGATTGCC
AAGGTCGACCAGCTGTCCGGGGAGCAGGAGGTGCTGAGGGGCGAGTTGGAGGCTGCTAAG
CAGGCCAAAGTCAAGCTGGAAAACCGTATCAAGGAGCTGGAAGAGGAACTGAAAAGAGTG
AAGTCCGAGGCCATCATCGCCCGCCGTGAACCCAAAGAAGAGGCGGAGGATGTAAGCAGC
TATCTCTGTACAGAATCGGACAAAATCCCCATGGCCCAGCGCCGCCGCTTCACGCGGGTG
GAGATGGCCCGTGTGCTCATGGAGCGGAACCAGTACAAGGAGCGGCTGATGGAGCTGCAG
GAGGCTGTGCGGTGGACTGAGATGATCAGAGCGTCCCGAGAGCACCCATCCGTCCAGGAG
AAGAAGAAGTCGACCATCTGGCAGTTCTTCAGCCGCCTCTTCAGCTCTTCCTCCAGCCCC
CCTCCGGCCAAGCGCCCCTATCCCTCGGTGAACATCCACTACAAGTCACCCACCACTGCC
GGCTTCAGCCAGCGCCGCAACCATGCCATGTGCCCGATCTCGGCAGGCAGCCGGCCCCTG
GAATTCTTCCCTGACGACGACTGCACGTCCTCCGCCCGTCGAGAGCAGAAGCGCGAGCAG
TACCGCCAGGTGCGTGAGCACGTGCGTAACGACGACGGCCGTCTGCAGGCCTGCGGCTGG
AGCCTGCCCGCCAAGTACAAGCAGCTGAGTCCCAACGGGGGCCAGGAGGACACGCGGATG
AAGAACGTGCCGGTGCCGGTGTACTGCCGCCCTCTGGTGGAGAAGGACCCCACCATGAAG
CTGTGGTGTGCCGCGGGCGTCAACCTGAGCGGGTGGAGGCCCAATGAGGACGACGCTGGG
AATGGAGTCAAGCCAGCGCCAGGCCGCGATCCCCTGACCTGCGACCGCGAAGGAGACGGC
GAGCCCAAGAGCGCCCACACGTCTCCCGAGAAGAAGAAGGCCAAGGAGCTCCCTGAAATG
GACGCCACCTCCAGCCGGGTGTGGATCCTGACCAGCACCCTGACCACCAGCAAGGTGGTG
ATCATCGACGCCAACCAGCCGGGCACGGTGGTGGACCAGTTCACCGTCTGCAACGCGCAC
GTGCTGTGCATCTCCAGCATCCCCGCGGCCAGCGACAGCGACTACCCTCCCGGGGAGATG
TTCCTGGACAGCGACGTGAACCCAGAGGACCCGGGCGCAGATGGCGTGCTGGCCGGTATC
ACCCTGGTGGGCTGTGCCACCCGCTGCAACGTGCCGCGGAGCAACTGCTCCTCCCGAGGG
GACACCCCAGTGCTAGACAAGGGGCAGGGGGAGGTGGCCACCATCGCCAACGGGAAGGTC
AACCCGTCCCAGTCCACAGAGGAGGCCACAGAGGCCACGGAGGTGCCAGACCCTGGGCCC
AGCGAGCCAGAGACAGCCACATTGCGGCCCGGGCCTCTCACAGAGCACGTCTTCACTGAC
CCAGCCCCGACCCCGTCCTCTGGCCCCCAGCCTGGCAGCGAGAACGGGCCAGAGCCTGAC
AGCAGCAGCACACGGCCAGAGCCAGAGCCCAGCGGGGACCCCACGGGAGCAGGCAGCAGT
GCTGCACCCACCATGTGGCTGGGAGCCCAGAACGGCTGGCTCTATGTGCACTCGGCTGTG
GCCAACTGGAAGAAGTGCCTGCACTCCATCAAGCTGAAGGATTCTGTGCTGAGCCTGGTG
CATGTCAAAGGCCGTGTGCTGGTGGCTCTGGCGGACGGGACCCTGGCCATCTTCCACCGT
GGTGAAGATGGCCAGTGGGATCTGAGCAACTATCACCTAATGGACCTGGGCCACCCGCAC
CACTCCATCCGCTGCATGGCTGTTGTGTACGACCGCGTGTGGTGTGGCTACAAGAACAAG
GTGCACGTCATCCAGCCCAAGACCATGCAGATAGAGAAGTCATTTGACGCCCACCCGCGG
CGGGAGAGCCAGGTGCGGCAGCTGGCGTGGATCGGCGATGGCGTATGGGTGTCCATCCGC
CTGGACTCCACCCTGAGGCTCTACCATGCACACACGCACCAGCATCTACAGGACGTGGAC
ATTGAGCCCTACGTCAGCAAGATGCTAGGCACTGGCAAGCTGGGTTTCTCCTTCGTACGC
ATCACGGCCCTGCTTGTCGCGGGCAGCCGGCTCTGGGTGGGCACCGGCAACGGAGTGGTC
ATCTCCATCCCCCTGACAGAGACTGTGGTCCTGCACCGAGGCCAGCTCCTGGGGCTCCGA
GCCAATAAGACATCCCCCACCTCTGGGGAGGGCGCCCGTCCCGGGGGCATCATCCACGTG
TATGGCGATGACAGCAGTGACAGGGCGGCCAGCAGCTTCATCCCCTACTGCTCCATGGCC
CAGGCCCAGCTATGCTTCCATGGGCACCGCGATGCCGTGAAGTTCTTTGTCTCGGTGCCA
GGGAACGTGCTGGCCACCCTGAATGGGAGTGTGCTGGACAGCCCAGCCGAGGGCCCTGGG
CCAGCTGCCCCTGCCTCGGAGGTCGAGGGCCAGAAGCTGCGGAACGTGCTGGTGCTGAGC
GGCGGGGAGGGCTACATCGACTTCCGCATTGGAGACGGAGAGGACGACGAGACGGAGGAG
GGCGCAGGGGACATGAGCCAGGTGAAGCCCGTGCTGTCCAAGGCAGAGCGCAGTCACATC
ATCGTGTGGCAGGTGTCCTACACCCCCGAGTGA
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:6884
Chromosome Location16
LocusNot Available
References
  1. Kikuno R, Nagase T, Ishikawa K, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Jun 30;6(3):197-205. 10470851
  2. Hattori A, Okumura K, Nagase T, Kikuno R, Hirosawa M, Ohara O: Characterization of long cDNA clones from human adult spleen. DNA Res. 2000 Dec 31;7(6):357-66. 11214971
  3. Daniels RJ, Peden JF, Lloyd C, Horsley SW, Clark K, Tufarelli C, Kearney L, Buckle VJ, Doggett NA, Flint J, Higgs DR: Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16. Hum Mol Genet. 2001 Feb 15;10(4):339-52. 11157797
  4. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. 15616553
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. 15489334
  6. Matsuura H, Nishitoh H, Takeda K, Matsuzawa A, Amagasa T, Ito M, Yoshioka K, Ichijo H: Phosphorylation-dependent scaffolding role of JSAP1/JIP3 in the ASK1-JNK signaling pathway. A new mode of regulation of the MAP kinase cascade. J Biol Chem. 2002 Oct 25;277(43):40703-9. Epub 2002 Aug 19. 12189133
  7. Ongusaha PP, Qi HH, Raj L, Kim YB, Aaronson SA, Davis RJ, Shi Y, Liao JK, Lee SW: Identification of ROCK1 as an upstream activator of the JIP-3 to JNK signaling axis in response to UVB damage. Sci Signal. 2008 Nov 25;1(47):ra14. doi: 10.1126/scisignal.1161938. 19036714