You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Toxin, Toxin Target Database.
NameCalcium-activated chloride channel regulator family member 3
Synonyms
  • Calcium-activated chloride channel family member 3
  • CLCA3
Gene NameCLCA3P
OrganismHuman
Amino acid sequence
>lcl|BSEQ0013971|Calcium-activated chloride channel regulator family member 3
MVFSLKVILFLSLLLSPVLKSSLVTLNNNGYDGIVIAINPSVPEDEKLIQNIKEMVTEAS
THLFHATKQRAYFRNVSILIPMTYKSKSEYLIPKQETYDQADVIVADLYLKYGDDPYTLQ
YGQCGDKGQYIHFTPNFLLTNNLATYGPRGKVFVHGWAHLRWGVFDEYNVDQPFYISRRN
TTEATRCSTRITVYMVLNECKGASCIARPFRRDSQTGLYEAKCTFIPKRSQTAKESIVFM
QNLDSVTEFCTEKTHNKEAPNL
Number of residues262
Molecular Weight29971.085
Theoretical pINot Available
GO Classification
Functions
  • transporter activity
  • voltage-gated ion channel activity
  • chloride channel activity
  • calcium channel activity
Processes
  • ion transmembrane transport
  • transport
  • transmembrane transport
Components
  • chloride channel complex
  • plasma membrane
  • extracellular space
General FunctionVoltage-gated ion channel activity
Specific FunctionNot Available
Pfam Domain Function
Transmembrane RegionsNot Available
GenBank Protein IDNot Available
UniProtKB IDQ9Y6N3
UniProtKB Entry NameCLCA3_HUMAN
Cellular LocationSecreted
Gene sequenceNot Available
GenBank Gene IDNot Available
GeneCard IDNot Available
GenAtlas IDNot Available
HGNC IDHGNC:2017
Chromosome LocationNot Available
LocusNot Available
References
  1. Gruber AD, Pauli BU: Molecular cloning and biochemical characterization of a truncated, secreted member of the human family of Ca2+-activated Cl- channels. Biochim Biophys Acta. 1999 Mar 19;1444(3):418-23. 10095065